BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0112.Seq (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 23 2.0 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 4.5 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 4.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.0 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 23.0 bits (47), Expect = 2.0 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 346 HWHSKR*NCYWP 381 HWHS R + Y+P Sbjct: 70 HWHSPRFHAYFP 81 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.8 bits (44), Expect = 4.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 486 LLEIAFALSFVQFYCYD*NGHHYYCSYYLSH 578 L A L F FYCY H Y LS+ Sbjct: 8 LTAAAVFLLFYLFYCYKTIKQHIYSLISLSY 38 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.8 bits (44), Expect = 4.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 486 LLEIAFALSFVQFYCYD*NGHHYYCSYYLSH 578 L A L F FYCY H Y LS+ Sbjct: 8 LTAAAVFLLFYLFYCYKTIKQHIYSLISLSY 38 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 6.0 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = +1 Query: 346 HWHSKR*NCYWP 381 HW+ +R C WP Sbjct: 1136 HWNKERKICDWP 1147 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,232 Number of Sequences: 336 Number of extensions: 2026 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -