BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0112.Seq (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0085 + 663694-665022 28 6.5 07_01_0086 + 672173-673603 27 8.6 01_06_0789 - 32010131-32010330,32010438-32010866,32011658-320117... 27 8.6 >07_01_0085 + 663694-665022 Length = 442 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -3 Query: 254 VILFGHRSAPRLITIAGTMRW 192 V+ GH S PRL TI G RW Sbjct: 149 VVAIGHYSQPRLPTIDGMDRW 169 >07_01_0086 + 672173-673603 Length = 476 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 Query: 254 VILFGHRSAPRLITIAGTMRW 192 V+ GH S PRL T+ G RW Sbjct: 172 VVAIGHYSQPRLPTVDGMDRW 192 >01_06_0789 - 32010131-32010330,32010438-32010866,32011658-32011752, 32011836-32011933,32012586-32012942,32013615-32013792, 32013856-32013936,32014441-32014548,32014916-32015178 Length = 602 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -2 Query: 474 RISQAVHRNLPRPLMDLKAPSQQVNTRAANQRPVAVLALRVPVK 343 R VH LPRP + + P QV R A +PV + VP+K Sbjct: 48 RSHHVVHVPLPRPAVAVAVPVPQV--RPAQPQPVPRPPVAVPLK 89 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,402,978 Number of Sequences: 37544 Number of extensions: 187645 Number of successful extensions: 428 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 428 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -