BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0111.Seq (598 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF160897-1|AAD46837.1| 390|Drosophila melanogaster GM14838p pro... 32 0.51 AE014134-1208|AAF52469.1| 390|Drosophila melanogaster CG3433-PA... 32 0.51 >AF160897-1|AAD46837.1| 390|Drosophila melanogaster GM14838p protein. Length = 390 Score = 32.3 bits (70), Expect = 0.51 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -2 Query: 459 AHGLNLREFANTSHSKSSASQILRPDPNRDPSIHFNY 349 A G NL+E A+ S S ++ P P+IHFNY Sbjct: 162 ARGKNLKEGASLPFFASGVSAVIHPRNPHVPTIHFNY 198 >AE014134-1208|AAF52469.1| 390|Drosophila melanogaster CG3433-PA protein. Length = 390 Score = 32.3 bits (70), Expect = 0.51 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -2 Query: 459 AHGLNLREFANTSHSKSSASQILRPDPNRDPSIHFNY 349 A G NL+E A+ S S ++ P P+IHFNY Sbjct: 162 ARGKNLKEGASLPFFASGVSAVIHPRNPHVPTIHFNY 198 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,085,891 Number of Sequences: 53049 Number of extensions: 474874 Number of successful extensions: 1080 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1068 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1080 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2420893683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -