BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0110.Seq (618 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 27 0.19 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 25 0.59 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 25 0.59 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 25 0.59 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 25 0.78 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 25 0.78 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 24 1.0 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 24 1.0 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 24 1.4 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 24 1.4 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 24 1.4 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 24 1.4 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 24 1.4 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 24 1.4 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 24 1.4 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 24 1.4 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 1.8 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 1.8 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 23 2.4 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 23 2.4 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 23 3.2 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 23 3.2 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 23 3.2 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 23 3.2 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 23 3.2 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 23 3.2 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 23 3.2 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 23 3.2 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 22 4.2 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 22 4.2 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 22 4.2 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 22 4.2 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 22 4.2 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 22 4.2 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 22 4.2 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 22 4.2 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 4.2 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 4.2 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 5.5 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 5.5 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 5.5 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 5.5 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 5.5 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 5.5 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 5.5 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 5.5 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 5.5 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 7.3 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 9.6 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 9.6 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 26.6 bits (56), Expect = 0.19 Identities = 16/70 (22%), Positives = 36/70 (51%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINL 65 + +++Y+ + + +K + + ERE + EP++ +LS+ I+ + NN+ N Sbjct: 278 REQNSYKNEREYRKYRERSKERSRDRTERERSREPKIISSLSNKT-IHNNNNYNNNNYNN 336 Query: 64 KPDNFWINKY 35 +N+ N Y Sbjct: 337 NYNNYNNNNY 346 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 25.0 bits (52), Expect = 0.59 Identities = 13/65 (20%), Positives = 32/65 (49%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINL 65 + + +Y+ + + +K + + ERE + EP++ +LS+ + + NN+ N Sbjct: 45 REQKSYKNEREYRKYRETSKERSQDRTERETSKEPKIISSLSNNYKYSNYNNYNNNYNNN 104 Query: 64 KPDNF 50 +N+ Sbjct: 105 YNNNY 109 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 25.0 bits (52), Expect = 0.59 Identities = 13/65 (20%), Positives = 32/65 (49%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINL 65 + + +Y+ + + +K + + ERE + EP++ +LS+ + + NN+ N Sbjct: 45 REQKSYKNEREYRKYRETSKERSQDRTERETSKEPKIISSLSNNYKYSNYNNYNNNYNNN 104 Query: 64 KPDNF 50 +N+ Sbjct: 105 YNNNY 109 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 25.0 bits (52), Expect = 0.59 Identities = 15/71 (21%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINL 65 + + +Y+ + + +K + + ERE + EP++ +LS+ + + NN+ N Sbjct: 278 REQKSYKNEREYRKYGETSKERSRDRTERERSKEPKIISSLSNNYKYSNYNNYNNNYNNY 337 Query: 64 KP-DNFWINKY 35 +N + N Y Sbjct: 338 NNYNNNYNNNY 348 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 24.6 bits (51), Expect = 0.78 Identities = 12/59 (20%), Positives = 30/59 (50%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHIN 68 + +++Y+ + + +K + + ERE + EP++ +LS+ + + NN+ N Sbjct: 45 REQNSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSNNYNYSNYNNYNNNYNN 103 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 24.6 bits (51), Expect = 0.78 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -3 Query: 172 ENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNFWINKY 35 + ERE + EP++ +LS+ N + NN+ N +N N Y Sbjct: 69 DRTERERSREPKIISSLSNKTIHNNNNYNNNNYNNYNYNNNNYNNY 114 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 24.2 bits (50), Expect = 1.0 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -1 Query: 459 ETQSLE--YTTSTTQDIISPRDEANFSVGKNEKIDSDEQMIGIAANL 325 E QS E +TTST D+ N ++G +E E+M+G L Sbjct: 560 ERQSSESPFTTSTIMPSDIFYDKLNKAIGGSEPFTYSEKMLGFPERL 606 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 24.2 bits (50), Expect = 1.0 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -1 Query: 459 ETQSLE--YTTSTTQDIISPRDEANFSVGKNEKIDSDEQMIGIAANL 325 E QS E +TTST D+ N ++G +E E+M+G L Sbjct: 560 ERQSSESPFTTSTIMPSDIFYDKLNKAIGGSEPFTYSEKMLGFPERL 606 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/67 (19%), Positives = 32/67 (47%) Frame = -3 Query: 274 NRNFWY*ENVKREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVV 95 +RN + + +++Y+ + + +K + + ERE EP++ +LS+ + Sbjct: 35 SRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERCKEPKIISSLSNNYKYSNY 94 Query: 94 DPITNNH 74 + NN+ Sbjct: 95 NNYNNNY 101 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/67 (19%), Positives = 32/67 (47%) Frame = -3 Query: 274 NRNFWY*ENVKREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVV 95 +RN + + +++Y+ + + +K + + ERE EP++ +LS+ + Sbjct: 35 SRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERCKEPKIISSLSNNYKYSNY 94 Query: 94 DPITNNH 74 + NN+ Sbjct: 95 NNYNNNY 101 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/67 (19%), Positives = 32/67 (47%) Frame = -3 Query: 274 NRNFWY*ENVKREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVV 95 +RN + + +++Y+ + + +K + + ERE EP++ +LS+ + Sbjct: 35 SRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERCKEPKIISSLSNNYKYSNY 94 Query: 94 DPITNNH 74 + NN+ Sbjct: 95 NNYNNNY 101 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/67 (19%), Positives = 32/67 (47%) Frame = -3 Query: 274 NRNFWY*ENVKREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVV 95 +RN + + +++Y+ + + +K + + ERE EP++ +LS+ + Sbjct: 35 SRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERCKEPKIISSLSNNYKYSNY 94 Query: 94 DPITNNH 74 + NN+ Sbjct: 95 NNYNNNY 101 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/67 (19%), Positives = 32/67 (47%) Frame = -3 Query: 274 NRNFWY*ENVKREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVV 95 +RN + + +++Y+ + + +K + + ERE EP++ +LS+ + Sbjct: 35 SRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERCKEPKIISSLSNNYKYSNY 94 Query: 94 DPITNNH 74 + NN+ Sbjct: 95 NNYNNNY 101 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/67 (19%), Positives = 32/67 (47%) Frame = -3 Query: 274 NRNFWY*ENVKREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVV 95 +RN + + +++Y+ + + +K + + ERE EP++ +LS+ + Sbjct: 35 SRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERCKEPKIISSLSNNYKYSNY 94 Query: 94 DPITNNH 74 + NN+ Sbjct: 95 NNYNNNY 101 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/67 (19%), Positives = 32/67 (47%) Frame = -3 Query: 274 NRNFWY*ENVKREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVV 95 +RN + + +++Y+ + + +K + + ERE EP++ +LS+ + Sbjct: 35 SRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERCKEPKIISSLSNNYKYSNY 94 Query: 94 DPITNNH 74 + NN+ Sbjct: 95 NNYNNNY 101 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.4 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -3 Query: 172 ENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNFWIN 41 + ERE + EP++ +LS+ N + NN+ N K + IN Sbjct: 69 DRTERERSREPKIISSLSNKTIHNNNNYNNNNYNNYKKLYYNIN 112 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/43 (23%), Positives = 24/43 (55%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSD 116 + + +Y+ + + +K K + +ERE + EP++ +LS+ Sbjct: 267 REQKSYKNEREYRKYGKTSKERSRDRMERERSKEPKIISSLSN 309 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.4 bits (48), Expect = 1.8 Identities = 13/61 (21%), Positives = 29/61 (47%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINL 65 + + +Y+ + +K + + ERE + E ++ +LS+ N+ + NN+ N Sbjct: 283 REQKSYKNENSYRKYRETSKERSRDKTERERSKERKIISSLSNNYISNISNYNNNNNYNK 342 Query: 64 K 62 K Sbjct: 343 K 343 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.4 Identities = 13/65 (20%), Positives = 31/65 (47%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINL 65 + +++Y+ + + +K + + ERE + EP++ +LS+ N N+ N Sbjct: 44 REQNSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYKYNYNNNNY 103 Query: 64 KPDNF 50 +N+ Sbjct: 104 NNNNY 108 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.4 Identities = 13/65 (20%), Positives = 31/65 (47%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINL 65 + +++Y+ + + +K + + ERE + EP++ +LS+ N N+ N Sbjct: 44 REQNSYKNEREYRKYRETSKERSRDRAERERSREPKIISSLSNNTIHNNNYKYNYNNNNY 103 Query: 64 KPDNF 50 +N+ Sbjct: 104 NNNNY 108 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSD 116 + + +Y+ + +K K + ERE + EP++ +LS+ Sbjct: 45 REQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSN 87 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSD 116 + + +Y+ + +K K + ERE + EP++ +LS+ Sbjct: 45 REQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSN 87 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSD 116 + + +Y+ + +K K + ERE + EP++ +LS+ Sbjct: 45 REQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSN 87 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSD 116 + + +Y+ + +K K + ERE + EP++ +LS+ Sbjct: 45 REQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSN 87 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSD 116 + + +Y+ + +K K + ERE + EP++ +LS+ Sbjct: 45 REQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSN 87 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSD 116 + + +Y+ + +K K + ERE + EP++ +LS+ Sbjct: 45 REQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSN 87 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.6 bits (46), Expect = 3.2 Identities = 13/61 (21%), Positives = 31/61 (50%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINL 65 + +++Y+ + + +K + + ERE + E ++ +LS+ N+ + NN+ N Sbjct: 45 REQNSYKNEKEYRKYRERSKERSRDKRERERSKERKIISSLSNNYISNISNYNNNNNYNK 104 Query: 64 K 62 K Sbjct: 105 K 105 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 22.6 bits (46), Expect = 3.2 Identities = 14/68 (20%), Positives = 31/68 (45%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINL 65 + + +Y+ + +K + + ERE + EP++ +LS+ + + N + L Sbjct: 45 REQKSYKNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNYNKKL 104 Query: 64 KPDNFWIN 41 N+ IN Sbjct: 105 YYKNYIIN 112 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/59 (18%), Positives = 29/59 (49%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHIN 68 + + +Y+ + + ++ + + ERE + EP++ +LS+ + + NN+ N Sbjct: 45 REQKSYKNEREYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNNNYN 103 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/59 (18%), Positives = 29/59 (49%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHIN 68 + + +Y+ + + ++ + + ERE + EP++ +LS+ + + NN+ N Sbjct: 45 REQKSYKNEREYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNNNYN 103 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/59 (18%), Positives = 29/59 (49%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHIN 68 + + +Y+ + + ++ + + ERE + EP++ +LS+ + + NN+ N Sbjct: 45 REQKSYKNEREYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNNNYN 103 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/59 (18%), Positives = 29/59 (49%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHIN 68 + + +Y+ + + ++ + + ERE + EP++ +LS+ + + NN+ N Sbjct: 45 REQKSYKNEREYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNNNYN 103 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/43 (20%), Positives = 24/43 (55%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSD 116 + +++Y+ + + +K + + ERE + EP++ +LS+ Sbjct: 45 REQNSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSN 87 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/43 (20%), Positives = 24/43 (55%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSD 116 + +++Y+ + + +K + + ERE + EP++ +LS+ Sbjct: 45 REQNSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSN 87 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/43 (20%), Positives = 24/43 (55%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSD 116 + +++Y+ + + +K + + ERE + EP++ +LS+ Sbjct: 45 REQNSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSN 87 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/43 (20%), Positives = 24/43 (55%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSD 116 + +++Y+ + + +K + + ERE + EP++ +LS+ Sbjct: 45 REQNSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSN 87 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/43 (20%), Positives = 24/43 (55%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSD 116 + +++Y+ + + +K + + ERE + EP++ +LS+ Sbjct: 45 REQNSYKNEKEYRKYRETSKERSRDRTERERSREPKIISSLSN 87 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 4.2 Identities = 15/70 (21%), Positives = 32/70 (45%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINL 65 + + +Y+ + +K + + ERE + EP++ +LS+ N + N + N Sbjct: 278 REQKSYKNENSYRKYRETSKERSRDRTERERSREPKIISSLSNKTIHNNNNYKYNYNNNN 337 Query: 64 KPDNFWINKY 35 +N + N Y Sbjct: 338 YNNNNYNNNY 347 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/57 (19%), Positives = 29/57 (50%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNH 74 + +++Y+ + + +K + + ERE + EP++ +LS+ + + NN+ Sbjct: 45 REQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIVSSLSNNYNYSNYNNYNNNN 101 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/57 (19%), Positives = 29/57 (50%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNH 74 + +++Y+ + + +K + + ERE + EP++ +LS+ + + NN+ Sbjct: 45 REQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSNYNNYNNNN 101 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/57 (19%), Positives = 29/57 (50%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNH 74 + +++Y+ + + +K + + ERE + EP++ +LS+ + + NN+ Sbjct: 45 REQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSNYNNYNNNN 101 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/57 (19%), Positives = 29/57 (50%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNH 74 + +++Y+ + + +K + + ERE + EP++ +LS+ + + NN+ Sbjct: 45 REQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSNYNNYNNNN 101 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/57 (19%), Positives = 29/57 (50%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNH 74 + +++Y+ + + +K + + ERE + EP++ +LS+ + + NN+ Sbjct: 45 REQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSNYNNYNNNN 101 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/57 (19%), Positives = 29/57 (50%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNH 74 + +++Y+ + + +K + + ERE + EP++ +LS+ + + NN+ Sbjct: 45 REQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSNYNNYNNNN 101 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/57 (19%), Positives = 29/57 (50%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNH 74 + +++Y+ + + +K + + ERE + EP++ +LS+ + + NN+ Sbjct: 45 REQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSNYNNYNNNN 101 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/57 (19%), Positives = 29/57 (50%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNH 74 + +++Y+ + + +K + + ERE + EP++ +LS+ + + NN+ Sbjct: 45 REQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSNYNNYNNNN 101 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 5.5 Identities = 9/43 (20%), Positives = 23/43 (53%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSD 116 + + +Y+ + +K + + +ERE + EP++ +LS+ Sbjct: 278 REQRSYKNENSYRKYRETSKERSRDRIERERSREPKIISSLSN 320 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/44 (20%), Positives = 25/44 (56%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDA 113 + +++Y+ + + +K + + ERE + EP++ +LS++ Sbjct: 267 REQNSYKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNS 310 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/43 (20%), Positives = 22/43 (51%) Frame = -3 Query: 244 KREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSD 116 + + +Y+ + +K + + ERE + EP++ +LS+ Sbjct: 45 REQKSYKNENSYRKYRETSKERSRDRTERERSREPKIISSLSN 87 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.0 bits (42), Expect = 9.6 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = -1 Query: 306 EVKTGDKESDKIETSGIE 253 E+K G+ +++++ GIE Sbjct: 470 EIKAGEIDAERLNNQGIE 487 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,216 Number of Sequences: 438 Number of extensions: 3187 Number of successful extensions: 50 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -