BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0108.Seq (618 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 24 3.4 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 24 4.5 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 24.2 bits (50), Expect = 3.4 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 267 AIQTARTKSISEAKKAFLNATVSPNAPPTKPDKRIEPTVHYAQLDIITK 413 A + +R +S S+ K+ + S NAP P EP+V+ + + +K Sbjct: 347 ATRMSRGRSRSQTKR-YSQTVESTNAPSRSPGPDEEPSVYKSLAEAASK 394 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.8 bits (49), Expect = 4.5 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 344 PSHQTGQKDRTNSTLCTTRYYNEKRRHEKHWR 439 PSH G DR N + R RR E+ R Sbjct: 1050 PSHPVGPSDR-NQVIAARRERRNARRRERRAR 1080 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 571,739 Number of Sequences: 2352 Number of extensions: 10764 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -