BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0107.Seq (568 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 25 0.34 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 25 0.34 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 22 3.2 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 22 3.2 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 5.6 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 25.4 bits (53), Expect = 0.34 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 125 SHFTVKEKAILVKKLSLCLYYYKIRISRYVIN 30 +H K+K K+ S C+Y Y + RY++N Sbjct: 109 AHLKDKKKIRAKKRWSQCMYMYFLLGFRYLVN 140 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 25.4 bits (53), Expect = 0.34 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 125 SHFTVKEKAILVKKLSLCLYYYKIRISRYVIN 30 +H K+K K+ S C+Y Y + RY++N Sbjct: 423 AHLKDKKKIRAKKRWSQCMYMYFLLGFRYLVN 454 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 22.2 bits (45), Expect = 3.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 435 TLLSVHIVFRXVLN*NN 485 TLLSV+ +FR N NN Sbjct: 66 TLLSVYSLFRIATNENN 82 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 22.2 bits (45), Expect = 3.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 435 TLLSVHIVFRXVLN*NN 485 TLLSV+ +FR N NN Sbjct: 66 TLLSVYSLFRIATNENN 82 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.4 bits (43), Expect = 5.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 282 SERFTRNKIKFIDTMY 235 S R +RN I+F+ MY Sbjct: 2 SYRLSRNDIRFLKVMY 17 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,247 Number of Sequences: 336 Number of extensions: 2583 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13995094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -