BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0106.Seq (648 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC342.03 |||1,3-beta-glucanosyltransferase |Schizosaccharomyce... 28 1.3 SPAC56F8.06c |alg10||dolichyl-phosphate-glucose-glycolipid alpha... 26 5.4 >SPBC342.03 |||1,3-beta-glucanosyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 456 Score = 27.9 bits (59), Expect = 1.3 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -1 Query: 300 DTFSHT-ETVHLPLPSNRLYLQHLLATLN 217 +T+ H+ H L N++YLQHL AT++ Sbjct: 113 NTYRHSISRAHPALSYNKVYLQHLFATID 141 >SPAC56F8.06c |alg10||dolichyl-phosphate-glucose-glycolipid alpha-glucosyltransferase Alg10|Schizosaccharomyces pombe|chr 1|||Manual Length = 445 Score = 25.8 bits (54), Expect = 5.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 429 AFVVLTVLSFFFIFLSYSNNFQCLF*N*PCCYCS 328 A V+LT++SF +FL F C + +CS Sbjct: 198 ADVLLTIISFLGVFLKNLRRFSCPILSYGAVFCS 231 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,393,058 Number of Sequences: 5004 Number of extensions: 44358 Number of successful extensions: 99 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -