BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0105.Seq (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0610 + 24335153-24337724,24337835-24338256 30 1.8 02_01_0075 - 522554-522616,522742-522748,523033-523136,523237-52... 29 3.2 01_01_0802 + 6246267-6247541,6247625-6247682,6247806-6248129,624... 29 4.2 11_06_0109 + 20202629-20205452,20206354-20206578,20207208-202080... 28 7.4 04_01_0492 + 6476586-6476873,6477414-6477686,6477769-6477948,647... 27 9.7 01_06_0445 - 29441472-29442152,29442244-29442357,29442959-294431... 27 9.7 >02_04_0610 + 24335153-24337724,24337835-24338256 Length = 997 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +1 Query: 166 SLLNLMILKLTSREITSNIPESLSR 240 +L L+ LKLTS ++T NIP +L R Sbjct: 481 NLRQLVYLKLTSNKLTGNIPNALDR 505 >02_01_0075 - 522554-522616,522742-522748,523033-523136,523237-523368, 525209-525401,525978-526330,526693-526791,526864-526935, 527062-527213,527338-527386,527755-527885,528067-528307, 528392-528565,528656-528797,529236-529282,529370-529450, 530170-530271,530345-530440,531437-531444,531575-531616, 531830-531894,534761-534853,534888-534959,535303-535509, 536318-537226,537503-538158 Length = 1429 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 93 VWEDDDDLFPGFSDTFKMPEIPEIKSLEFDD 185 +W+ DDD FP F+ IP+ S +FDD Sbjct: 1072 IWDSDDD-FPNEEKHFRTQIIPKDLSQDFDD 1101 >01_01_0802 + 6246267-6247541,6247625-6247682,6247806-6248129, 6248321-6248355 Length = 563 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +3 Query: 99 EDDDDLFPGFSDTFKMPEIPEIKSLEFDDIKTHVAGDNEQYTG 227 E + D P +T PE PE S++ + K + A DNE+Y G Sbjct: 413 EVEQDQMPPVQETLHNPE-PE--SIDIEPPKENTADDNERYVG 452 >11_06_0109 + 20202629-20205452,20206354-20206578,20207208-20208091, 20208692-20208814 Length = 1351 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 169 LLNLMILKLTSREITSNIPESLSRVTVPHH 258 L L IL+L+ + +IP S++++T HH Sbjct: 725 LTELQILRLSHNSFSGDIPRSITKLTNLHH 754 >04_01_0492 + 6476586-6476873,6477414-6477686,6477769-6477948, 6478436-6478696,6479171-6479303,6479404-6479494, 6479921-6480023,6480557-6480660,6480809-6480902, 6480985-6481140,6481224-6481286,6481388-6481453, 6481670-6481870,6481999-6482076,6482165-6482284, 6482382-6482462,6482548-6482633,6482920-6483031, 6483093-6483170,6483306-6483482 Length = 914 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +3 Query: 93 VWEDDDDLFPGFSDTFKMPEIPEIKSLEFDDIKTHVAGDNEQY 221 VW+DD L G+ + K+ I S + I+ + NE+Y Sbjct: 245 VWQDDTILVIGWGTSVKIAAIRTDSSQGLNGIQRSITASNEKY 287 >01_06_0445 - 29441472-29442152,29442244-29442357,29442959-29443186, 29443284-29443586 Length = 441 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 162 SLVSLAS*TYLRIPGTNRHRPPIQSQRS 79 S +SL R+ G H+PP+Q QRS Sbjct: 357 SYMSLTKSAKARLSGYGSHKPPLQRQRS 384 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,546,378 Number of Sequences: 37544 Number of extensions: 236731 Number of successful extensions: 608 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 608 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -