BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0098.Seq (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 144 6e-35 SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 116 1e-26 SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_33690| Best HMM Match : Fer4 (HMM E-Value=2.1) 29 2.9 SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) 28 5.0 SB_32242| Best HMM Match : Pam16 (HMM E-Value=7.4e-20) 27 8.7 SB_54786| Best HMM Match : Ribosomal_S12 (HMM E-Value=1.4e-12) 27 8.7 SB_47788| Best HMM Match : Cir_Bir_Yir (HMM E-Value=8.6) 27 8.7 SB_33607| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) 27 8.7 SB_4381| Best HMM Match : RVT_1 (HMM E-Value=3) 27 8.7 SB_3221| Best HMM Match : rve (HMM E-Value=3) 27 8.7 >SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 413 Score = 144 bits (348), Expect = 6e-35 Identities = 66/78 (84%), Positives = 72/78 (92%) Frame = +1 Query: 4 KPRGIRTARKHVNHRREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQP 183 KPRG+RTARK +HRR+Q+W DK +KKAH+GT KANPFGGASHAKGIVLEKVGVEAKQP Sbjct: 2 KPRGLRTARKLRSHRRDQKWHDKAYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQP 61 Query: 184 NSAIRKCVRVQLIKNGKK 237 NSAIRKCVRVQLIKNGKK Sbjct: 62 NSAIRKCVRVQLIKNGKK 79 Score = 69.3 bits (162), Expect = 2e-12 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 252 PRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGV 350 P DGCLN+IEENDEVL++GFGR+GHAVGDIPG+ Sbjct: 85 PNDGCLNYIEENDEVLISGFGRRGHAVGDIPGI 117 >SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 143 Score = 116 bits (279), Expect = 1e-26 Identities = 52/58 (89%), Positives = 57/58 (98%) Frame = +3 Query: 252 PRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 425 P DGCLN+IEENDEVL++GFGR+GHAVGDIPGVRFKVVKVANVSLLAL+KEKKERPRS Sbjct: 86 PNDGCLNYIEENDEVLISGFGRRGHAVGDIPGVRFKVVKVANVSLLALFKEKKERPRS 143 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 154 EKVGVEAKQPNSAIRKCVRVQLIKNGKK 237 ++ GVEAKQPNSAIRKCVRVQLIKNGKK Sbjct: 53 QEPGVEAKQPNSAIRKCVRVQLIKNGKK 80 >SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 84 SPHGYEMEG*PFRWCISRKGHRPRESWCRS*AA 182 S HG MEG P W +S G P+ S C S +A Sbjct: 85 SQHGTRMEGVPVCWYVSVWGLSPQVSQCDSVSA 117 >SB_33690| Best HMM Match : Fer4 (HMM E-Value=2.1) Length = 488 Score = 29.1 bits (62), Expect = 2.9 Identities = 24/78 (30%), Positives = 30/78 (38%), Gaps = 5/78 (6%) Frame = -3 Query: 221 MSCTRTHLRMAELGCLASTPTFSR-----TMPFA*DAPPKGLAFHFVPMWAFLNSLSAHR 57 M C + E+ C PT R T DA P GL H M L+ + R Sbjct: 58 MPCQLDYPNYREMPCQLDCPTTERCPANWTTQLQRDALPTGLPKHR-EMPCQLDYPTTER 116 Query: 56 CSRRWFTCLRAVRIPRGL 3 C W T L+ +P GL Sbjct: 117 CPANWTTQLQRDALPTGL 134 >SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) Length = 943 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -3 Query: 152 RTMPFA*D-APPKGLAFHFVPMW-AFLN-SLSAHR 57 R +PF+ APPKG F VP+W +F N S+ HR Sbjct: 902 RKVPFSSVLAPPKGYRFLIVPLWRSFSNRSVFGHR 936 >SB_32242| Best HMM Match : Pam16 (HMM E-Value=7.4e-20) Length = 255 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 44 TVVNSDGRTKNSRKPTWVRNGRLTLSVVHLT 136 T V R N++KP +R+GR+T+S+ +T Sbjct: 103 THVQFHHRDTNTKKPVHLRDGRVTVSLAAMT 133 >SB_54786| Best HMM Match : Ribosomal_S12 (HMM E-Value=1.4e-12) Length = 302 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 139 KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGK 234 KG+ ++ + K+PNSA RKC ++L NGK Sbjct: 230 KGVCVKVFIRKPKKPNSAQRKCALLKL-SNGK 260 >SB_47788| Best HMM Match : Cir_Bir_Yir (HMM E-Value=8.6) Length = 294 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -2 Query: 252 DECGHFLSVLNELYTDAFADGRVGLLSFYTNFLED 148 D+ F NE AD R GL+ NF+ED Sbjct: 114 DKLNRFFVTTNERTLGTKADDRSGLIELVNNFVED 148 >SB_33607| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) Length = 256 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 76 ILCPPIAVHDGGSRAYAPFV 17 ++ PP + DG SRA+APF+ Sbjct: 215 LIKPPSTIVDGRSRAHAPFI 234 >SB_4381| Best HMM Match : RVT_1 (HMM E-Value=3) Length = 471 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -2 Query: 252 DECGHFLSVLNELYTDAFADGRVGLLSFYTNFLED 148 D+ F NE AD R GL+ NF+ED Sbjct: 163 DKLNRFFVTTNERTLGTKADDRSGLIELVNNFVED 197 >SB_3221| Best HMM Match : rve (HMM E-Value=3) Length = 324 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = -1 Query: 448 SLITMYTYDLGRSFFSL*RARRDTLATFTTLKRTPGMSPTA*PLRP 311 S T TYDL SF+S+ + + LAT +K++P + + L+P Sbjct: 9 SFDTFPTYDLA-SFYSVLCSGDEQLATIKLMKKSPSLFQKSHTLKP 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,814,933 Number of Sequences: 59808 Number of extensions: 382455 Number of successful extensions: 849 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 848 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -