BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0097.Seq (528 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 6.3 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 6.3 AJ302662-1|CAC35527.1| 76|Anopheles gambiae gSG9 protein protein. 23 8.4 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 23.0 bits (47), Expect = 6.3 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 115 GLLAPTTSWIVQFEGPQEITRVLELFSNSEDLMDEVLN 228 GLLAPTTS + E ++ V+ S + +DE+++ Sbjct: 2 GLLAPTTSCDGEEELQVQLRSVIITRSKAGATVDEIID 39 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.0 bits (47), Expect = 6.3 Identities = 7/28 (25%), Positives = 15/28 (53%) Frame = -1 Query: 192 EKFKYASNFLWPFKLNNPTGGWRKKTIH 109 E+F + ++ +P + G W K ++H Sbjct: 14 EQFHFLNDLKYPVLIRQHLGNWIKDSLH 41 >AJ302662-1|CAC35527.1| 76|Anopheles gambiae gSG9 protein protein. Length = 76 Score = 22.6 bits (46), Expect = 8.4 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +1 Query: 13 FFYNYKSIYLNHPPEKIVDLVFAVTKVSAVDIMNG 117 FF+ Y YL+ P ++ V + S V + G Sbjct: 26 FFFQYNRPYLSQPSSQLASTAANVVQRSNVTVALG 60 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 585,258 Number of Sequences: 2352 Number of extensions: 12825 Number of successful extensions: 73 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -