BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0095.Seq (705 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ138932-1|ABA86538.1| 1387|Drosophila melanogaster CG12105 prot... 31 1.2 AY069579-1|AAL39724.1| 1491|Drosophila melanogaster LD31673p pro... 30 2.7 AF250842-1|AAF66060.1| 1491|Drosophila melanogaster multiple ast... 30 2.7 AF195498-1|AAG28470.1| 1491|Drosophila melanogaster Misexpressio... 30 2.7 AE014296-3475|AAN12153.1| 1491|Drosophila melanogaster CG32435-P... 30 2.7 AE014296-3474|AAN12152.1| 1491|Drosophila melanogaster CG32435-P... 30 2.7 AE014296-3473|AAN12151.1| 1491|Drosophila melanogaster CG32435-P... 30 2.7 AB031048-1|BAA94248.1| 1492|Drosophila melanogaster microtubule ... 30 2.7 BT021372-1|AAX33520.1| 2286|Drosophila melanogaster LP05745p pro... 29 4.7 AE014134-3630|EAA46011.1| 2286|Drosophila melanogaster CG18140-P... 29 4.7 AE013599-1761|AAF58340.2| 1093|Drosophila melanogaster CG6280-PA... 29 6.2 >DQ138932-1|ABA86538.1| 1387|Drosophila melanogaster CG12105 protein. Length = 1387 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -3 Query: 589 NQGSIPEREPEKRLPHPRKAAGAQITHPG 503 N ++PE EPE PHP AA +T PG Sbjct: 112 NYRAMPEDEPEYPHPHPPTAATTTMTQPG 140 >AY069579-1|AAL39724.1| 1491|Drosophila melanogaster LD31673p protein. Length = 1491 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = -3 Query: 601 RVTGNQGSIPEREPEKRLPHPRKAAGAQITHPGTGR**RKITIRDSY 461 R+ N G P P P PR AG + PG+ +RD Y Sbjct: 631 RLNSNSGGTPATTPGSVTPRPRGRAGVSQSQPGSRSTSPSTKLRDQY 677 >AF250842-1|AAF66060.1| 1491|Drosophila melanogaster multiple asters protein. Length = 1491 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = -3 Query: 601 RVTGNQGSIPEREPEKRLPHPRKAAGAQITHPGTGR**RKITIRDSY 461 R+ N G P P P PR AG + PG+ +RD Y Sbjct: 631 RLNSNSGGTPATTPGSVTPRPRGRAGVSQSQPGSRSTSPSTKLRDQY 677 >AF195498-1|AAG28470.1| 1491|Drosophila melanogaster Misexpression suppressor of ras 7 protein. Length = 1491 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = -3 Query: 601 RVTGNQGSIPEREPEKRLPHPRKAAGAQITHPGTGR**RKITIRDSY 461 R+ N G P P P PR AG + PG+ +RD Y Sbjct: 631 RLNSNSGGTPATTPGSVTPRPRGRAGVSQSQPGSRSTSPSTKLRDQY 677 >AE014296-3475|AAN12153.1| 1491|Drosophila melanogaster CG32435-PC, isoform C protein. Length = 1491 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = -3 Query: 601 RVTGNQGSIPEREPEKRLPHPRKAAGAQITHPGTGR**RKITIRDSY 461 R+ N G P P P PR AG + PG+ +RD Y Sbjct: 631 RLNSNSGGTPATTPGSVTPRPRGRAGVSQSQPGSRSTSPSTKLRDQY 677 >AE014296-3474|AAN12152.1| 1491|Drosophila melanogaster CG32435-PB, isoform B protein. Length = 1491 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = -3 Query: 601 RVTGNQGSIPEREPEKRLPHPRKAAGAQITHPGTGR**RKITIRDSY 461 R+ N G P P P PR AG + PG+ +RD Y Sbjct: 631 RLNSNSGGTPATTPGSVTPRPRGRAGVSQSQPGSRSTSPSTKLRDQY 677 >AE014296-3473|AAN12151.1| 1491|Drosophila melanogaster CG32435-PA, isoform A protein. Length = 1491 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = -3 Query: 601 RVTGNQGSIPEREPEKRLPHPRKAAGAQITHPGTGR**RKITIRDSY 461 R+ N G P P P PR AG + PG+ +RD Y Sbjct: 631 RLNSNSGGTPATTPGSVTPRPRGRAGVSQSQPGSRSTSPSTKLRDQY 677 >AB031048-1|BAA94248.1| 1492|Drosophila melanogaster microtubule associated-proteinorbit protein. Length = 1492 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = -3 Query: 601 RVTGNQGSIPEREPEKRLPHPRKAAGAQITHPGTGR**RKITIRDSY 461 R+ N G P P P PR AG + PG+ +RD Y Sbjct: 631 RLNSNSGGTPATTPGSVTPRPRGRAGVSQSQPGSRSTSPSTKLRDQY 677 >BT021372-1|AAX33520.1| 2286|Drosophila melanogaster LP05745p protein. Length = 2286 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +1 Query: 340 RNNFSIRYWSWNYRGCWHQTCP--PIVPR*NI*SVL 441 R+ FS + WNY CW C P+ R N+ +L Sbjct: 327 RHGFSGLHLDWNYPKCWQSDCSRGPVTDRPNLTKLL 362 >AE014134-3630|EAA46011.1| 2286|Drosophila melanogaster CG18140-PA protein. Length = 2286 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +1 Query: 340 RNNFSIRYWSWNYRGCWHQTCP--PIVPR*NI*SVL 441 R+ FS + WNY CW C P+ R N+ +L Sbjct: 327 RHGFSGLHLDWNYPKCWQSDCSRGPVTDRPNLTKLL 362 >AE013599-1761|AAF58340.2| 1093|Drosophila melanogaster CG6280-PA protein. Length = 1093 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 538 LDVVAVSQAPSPESNPDSPLPVTTMVVAETTIRKLIRQTFG 660 +DVV+ ++A S E P P T +TT+ K R+ G Sbjct: 223 VDVVSTTEAASTEKQTKPPAPNATYYSYQTTVTKEYRRELG 263 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,192,369 Number of Sequences: 53049 Number of extensions: 697872 Number of successful extensions: 1699 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1698 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3108380451 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -