BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0089.Seq (399 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g42740.1 68414.m04939 hypothetical protein 27 3.5 At4g12780.1 68417.m02005 auxilin-related low similarity to SP|Q2... 27 4.6 >At1g42740.1 68414.m04939 hypothetical protein Length = 359 Score = 27.5 bits (58), Expect = 3.5 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +3 Query: 72 PVIPCVHPIPGGMYPGRMLRIQGRVPPGAQRFAINLQCGPNTDPRD 209 P IP HP + GR + +PP R + P +DP D Sbjct: 313 PPIPKCHPTDVPHFHGRSQALNAPIPPWMMRCSSKKHLLPPSDPPD 358 >At4g12780.1 68417.m02005 auxilin-related low similarity to SP|Q27974 Auxilin {Bos taurus} Length = 485 Score = 27.1 bits (57), Expect = 4.6 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -2 Query: 251 AHLHEAEVEVQRDVVPRVRVGSALQVDREPLCAGRHSALDA 129 A +E +++VQR+ V + R+G L V+ + AG+ L A Sbjct: 367 AEKNERDLQVQREQVEKDRIGVTLDVEIKRWGAGKEGNLRA 407 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.126 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,608,095 Number of Sequences: 28952 Number of extensions: 144632 Number of successful extensions: 358 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 358 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 575830496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -