Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0085.Seq
         (499 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    22   2.7  
AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    21   8.1  

>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 22.2 bits (45), Expect = 2.7
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -2

Query: 447 HHGYWNY 427
           HHG WNY
Sbjct: 72  HHGQWNY 78


>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 20.6 bits (41), Expect = 8.1
 Identities = 9/32 (28%), Positives = 15/32 (46%)
 Frame = +3

Query: 147 CKHRPCRIQYIGR*QHLWIQFQQS*WKCIIHG 242
           C H    +  + R Q L  Q  Q+ ++ + HG
Sbjct: 148 CFHSTLLLMILSRYQRLKAQLWQNRYETVAHG 179


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 107,381
Number of Sequences: 336
Number of extensions: 2594
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 11735024
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)