BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0085.Seq (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 27 0.47 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 25 1.4 AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding pr... 23 5.8 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 7.6 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 26.6 bits (56), Expect = 0.47 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 373 MQAPQKNPPRPLVAALKDIVPVAMMEA*HPPTVPAQVEELS 495 M + PPRPL +ALKDI + P + P+ + E S Sbjct: 1 MSGNESLPPRPLGSALKDIGAFFGRSSKTPRSPPSDLGECS 41 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 25.0 bits (52), Expect = 1.4 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Frame = +2 Query: 17 VPVTLMQAQTLQDPVHPAVAALMDTVPTVVMEVYHPPAVPVTLMQAQTLQDPVHRAVAAL 196 VPV + Q + P HP A VP V +VY P P+ + Q ++ P+++ + + Sbjct: 166 VPVPVFQKVGVPVP-HPVPIA----VPHYV-KVYIPQPYPLQVNVEQPIKIPIYKVIPKV 219 Query: 197 MD-TVPTVVMEVY 232 ++ VP V + Y Sbjct: 220 IEKPVPYTVEKPY 232 >AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding protein OBPjj5a protein. Length = 272 Score = 23.0 bits (47), Expect = 5.8 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 133 NCRWMIHFHHDCRNCIHKCCYRR 65 NCR +H RN + CY++ Sbjct: 151 NCRTAARRNHSSRNTCRRNCYQQ 173 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -1 Query: 184 RPMYWILQGLCLHQCYW 134 RPM W+LQ YW Sbjct: 1023 RPMSWLLQYFVSFATYW 1039 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 486,225 Number of Sequences: 2352 Number of extensions: 9281 Number of successful extensions: 23 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -