BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0085.Seq (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 33 0.14 At3g13890.1 68416.m01755 myb family transcription factor (MYB26)... 30 1.00 At3g28840.1 68416.m03598 expressed protein 29 1.7 At3g61670.1 68416.m06911 expressed protein weak similarity to ex... 29 2.3 At3g03790.2 68416.m00389 ankyrin repeat family protein / regulat... 29 2.3 At3g03790.1 68416.m00388 ankyrin repeat family protein / regulat... 29 2.3 At1g75560.1 68414.m08781 zinc knuckle (CCHC-type) family protein... 29 2.3 At5g51540.1 68418.m06391 peptidase M3 family protein / thimet ol... 28 4.0 At1g53130.1 68414.m06016 stigma-specific Stig1 family protein si... 27 5.3 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 27 7.0 At5g46780.2 68418.m05763 VQ motif-containing protein contains PF... 27 9.3 At5g46780.1 68418.m05762 VQ motif-containing protein contains PF... 27 9.3 At2g37640.1 68415.m04617 expansin, putative (EXP3) identical to ... 27 9.3 At1g69280.1 68414.m07943 expressed protein 27 9.3 At1g11460.1 68414.m01316 nodulin MtN21 family protein similar to... 27 9.3 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 32.7 bits (71), Expect = 0.14 Identities = 23/70 (32%), Positives = 28/70 (40%) Frame = +2 Query: 2 YHPPAVPVTLMQAQTLQDPVHPAVAALMDTVPTVVMEVYHPPAVPVTLMQAQTLQDPVHR 181 Y PP PV + T PV P T P V Y+PP PV A ++ P Sbjct: 157 YKPPTSPV---KPPTTTPPVKPPT-----TTPPVQPPTYNPPTTPVKPPTAPPVKPPTPP 208 Query: 182 AVAALMDTVP 211 V +D VP Sbjct: 209 PVRTRIDCVP 218 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +2 Query: 2 YHPPAVPVTLMQAQTLQDPVHPAVAALMDTVPTV-VMEVYHPPAVPVT 142 Y PP +P T ++ T + PV P + P V + PP P T Sbjct: 59 YKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPT 106 >At3g13890.1 68416.m01755 myb family transcription factor (MYB26) similar to myb-related transcription factor GI:1167486 from [Lycopersicon esculentum]; contains myb DNA binding domain: PF0049 Length = 367 Score = 29.9 bits (64), Expect = 1.00 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -1 Query: 226 FHHDCWNCIHKCCYRPMYWILQGLCLHQCYWNC--RWMIHFHHDCR 95 + H CW+ + K + Y + G CL +C +C RW+ + D + Sbjct: 32 YGHGCWSSVPK--HAGTYTHIHGFCLQRCGKSCRLRWINYLRPDLK 75 >At3g28840.1 68416.m03598 expressed protein Length = 391 Score = 29.1 bits (62), Expect = 1.7 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = -3 Query: 485 STCAGTVGGCYASIMATGTISFSAATSGRGGFFCGACISVTGTASG 348 +T G S A GT + A T+G G GA S GTA+G Sbjct: 230 TTATGGTTAAGGSTAAGGTTASGAGTAGYGATAGGATASGAGTAAG 275 >At3g61670.1 68416.m06911 expressed protein weak similarity to extra-large G-protein [Arabidopsis thaliana] GI:3201682 Length = 790 Score = 28.7 bits (61), Expect = 2.3 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 115 HFHHDCRNCIHKCCYRRMYW 56 HFHH +C H CY YW Sbjct: 322 HFHHSSCSCYH--CYDNKYW 339 Score = 28.3 bits (60), Expect = 3.0 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 229 HFHHDCWNCIHKCCYRPMYW 170 HFHH +C H CY YW Sbjct: 322 HFHHSSCSCYH--CYDNKYW 339 >At3g03790.2 68416.m00389 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein similar to hect domain and RLD 2 GB:NP_004658 [Homo sapiens]; contains Pfam PF00415: Regulator of chromosome condensation (RCC1); contains Pfam PF00023: Ankyrin repeat; similar to rjs (GI:3414809) [Mus musculus]; similar to HERC2 (GI:4079809) [Homo sapiens] Length = 1081 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 77 ALMDTVPTVVMEVYHPPAVPVTLMQAQTLQ 166 A+ +T VV +YHP P+ L ++QTLQ Sbjct: 497 AVGETHLLVVGSLYHPAYAPIVLKKSQTLQ 526 >At3g03790.1 68416.m00388 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein similar to hect domain and RLD 2 GB:NP_004658 [Homo sapiens]; contains Pfam PF00415: Regulator of chromosome condensation (RCC1); contains Pfam PF00023: Ankyrin repeat; similar to rjs (GI:3414809) [Mus musculus]; similar to HERC2 (GI:4079809) [Homo sapiens] Length = 1078 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 77 ALMDTVPTVVMEVYHPPAVPVTLMQAQTLQ 166 A+ +T VV +YHP P+ L ++QTLQ Sbjct: 494 AVGETHLLVVGSLYHPAYAPIVLKKSQTLQ 523 >At1g75560.1 68414.m08781 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 257 Score = 28.7 bits (61), Expect = 2.3 Identities = 19/60 (31%), Positives = 24/60 (40%), Gaps = 3/60 (5%) Frame = -1 Query: 247 NCPWMIHFHHDCWNC-IHKCCYRPMYWILQGLCLHQCYWNCRWMIHFHHDCRN--CIHKC 77 NC HF DC N + C P + + +C WNCR H +C N H C Sbjct: 59 NCKRPGHFARDCSNVSVCNNCGLPGHIAAECTAESRC-WNCREPGHVASNCSNEGICHSC 117 >At5g51540.1 68418.m06391 peptidase M3 family protein / thimet oligopeptidase family protein low similarity to SP|Q99797 Mitochondrial intermediate peptidase, mitochondrial precursor (EC 3.4.24.59) {Homo sapiens}; contains Pfam profile PF01432: Peptidase family M3 Length = 860 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/43 (32%), Positives = 19/43 (44%), Gaps = 10/43 (23%) Frame = -2 Query: 492 KLLHLCWNR----RWMLRFHH------GYWNYILQCCYQRTWW 394 K H WN W +RF H GY++Y+ C+ T W Sbjct: 601 KRQHTSWNHVEGTHWYIRFSHLLNYGAGYYSYLYAKCFASTIW 643 >At1g53130.1 68414.m06016 stigma-specific Stig1 family protein similar to stigma-specific protein STIG1 [Nicotiana tabacum] GI:496647; contains Pfam profile PF04885: Stigma-specific protein, Stig1 Length = 168 Score = 27.5 bits (58), Expect = 5.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 151 LHQCYWNCRWMIHFHHDCRNCIHKC 77 LH C +CR ++ ++C C HKC Sbjct: 102 LHCCKKHCRNVLGDRNNCGRCGHKC 126 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +2 Query: 2 YHPPAVPVTLMQAQTLQDPVHPAVAALMDTVPTVVMEVYHPP 127 Y PP P + + T P++P T PT +Y PP Sbjct: 63 YSPPIYPPPIQKPPTYSPPIYPPPIQKPPT-PTYSPPIYPPP 103 >At5g46780.2 68418.m05763 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 26.6 bits (56), Expect = 9.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 382 PQKNPPRPLVAALKDIVPVAMMEA*HPPTVP 474 PQ N P+P + L + P + + HPP P Sbjct: 75 PQTNHPKPPNSRLVKVRPAPLTQLNHPPPPP 105 >At5g46780.1 68418.m05762 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 26.6 bits (56), Expect = 9.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 382 PQKNPPRPLVAALKDIVPVAMMEA*HPPTVP 474 PQ N P+P + L + P + + HPP P Sbjct: 75 PQTNHPKPPNSRLVKVRPAPLTQLNHPPPPP 105 >At2g37640.1 68415.m04617 expansin, putative (EXP3) identical to Alpha-expansin 3 precursor (At-EXP3)[Arabidopsis thaliana] SWISS-PROT:O80932; alpha-expansin gene family, PMID:11641069 Length = 262 Score = 26.6 bits (56), Expect = 9.3 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 5/48 (10%) Frame = -3 Query: 485 STCAGTVGGC--YASIMATGTISFSAATSG---RGGFFCGACISVTGT 357 S +GT+GG Y ++ + G +AA S GF CGAC + T Sbjct: 47 SDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCT 94 >At1g69280.1 68414.m07943 expressed protein Length = 400 Score = 26.6 bits (56), Expect = 9.3 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 247 NCPWMIHFHHDCWNCIHKCC 188 +C W+ H CW+C CC Sbjct: 349 SCGWLFCCHWSCWSCC--CC 366 >At1g11460.1 68414.m01316 nodulin MtN21 family protein similar to MtN21 [Medicago truncatula] GI:2598575; contains Pfam profile PF00892: Integral membrane protein Length = 337 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = -2 Query: 444 HGYWNYILQCCYQRTWWIL--LWCLHQCYWNCQWPIHFHHDCLSYI 313 H N++L C Y +L LW L Q + ++P F CL I Sbjct: 183 HNTKNWLLGCLYLTIGTVLISLWILFQGTLSIKYPCKFSSTCLMSI 228 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,573,456 Number of Sequences: 28952 Number of extensions: 195987 Number of successful extensions: 587 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 585 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -