BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0079.Seq (648 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IM68 Cluster: Putative uncharacterized protein; n=1; ... 33 7.9 UniRef50_A5E6R8 Cluster: Putative uncharacterized protein; n=1; ... 33 7.9 >UniRef50_Q8IM68 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 879 Score = 32.7 bits (71), Expect = 7.9 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -2 Query: 443 MNFIIK---NTLQICFLFLYIYTLSILKFTTNLN*AFYHSLYIGIKK 312 M +II+ N + I F LY+Y +IL T N Y+ YI IKK Sbjct: 137 MKYIIESYTNNIDIIFFLLYLYVNNILNGTFVFNIQSYNEYYIKIKK 183 >UniRef50_A5E6R8 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 898 Score = 32.7 bits (71), Expect = 7.9 Identities = 18/61 (29%), Positives = 32/61 (52%) Frame = +3 Query: 459 TSSTHAPTRTQHYAGRRLPSTQQILNLKSNFFDKVQRCIHIHTTRYENVHLMMSIQSRKR 638 TS +AP + +A + Q++ L +N DK+ + H TRY+++ LM I+ K Sbjct: 347 TSDDYAPL-IRIFAKNMKDANIQVVQLSANCTDKIANALGSHFTRYQSLILMPVIERTKE 405 Query: 639 Q 641 + Sbjct: 406 K 406 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 580,806,630 Number of Sequences: 1657284 Number of extensions: 11413636 Number of successful extensions: 35550 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26020 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35005 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48955894634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -