BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0078.Seq (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 33 0.19 At3g08510.1 68416.m00988 phosphoinositide-specific phospholipase... 30 1.0 At2g07020.1 68415.m00803 protein kinase family protein contains ... 30 1.0 At2g21780.1 68415.m02589 expressed protein 29 1.8 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 32.7 bits (71), Expect = 0.19 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = -1 Query: 382 PITRPRKSPVSLFFVTTSPCREWVICAPAAFLGCGSRFSGSLSESNPDSPLPVT 221 PI+ P KSP + TTSP + + +P S S +P SP PV+ Sbjct: 24 PISSPTKSPTTPSAPTTSPTKSPAVTSPTTAPAKTPTASASSPVESPKSPAPVS 77 >At3g08510.1 68416.m00988 phosphoinositide-specific phospholipase C (PLC2) identical to phosphoinositide specific phospholipase C(AtPLC2) GI:857374 [Arabidopsis thaliana] Length = 581 Score = 30.3 bits (65), Expect = 1.0 Identities = 15/64 (23%), Positives = 30/64 (46%) Frame = -1 Query: 265 GSLSESNPDSPLPVTTMVVAETTIES**GRHLKDASPVLDHAICKSYPDSSKLTTSDARP 86 G ++E P V + ++E +E ++ K H + + YP +++T+S+ P Sbjct: 329 GGITECLKVDPDKVRRLSLSEEQLEKAAEKYAKQIVRFTQHNLLRIYPKGTRVTSSNYNP 388 Query: 85 SVDW 74 V W Sbjct: 389 LVGW 392 >At2g07020.1 68415.m00803 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 700 Score = 30.3 bits (65), Expect = 1.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 121 DSSKLTTSDARPSVDWF*SNKSTHPITGQSSD 26 DS S RPS+DWF N+S + + SS+ Sbjct: 223 DSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254 >At2g21780.1 68415.m02589 expressed protein Length = 112 Score = 29.5 bits (63), Expect = 1.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 234 GESGFDSEREPEKRLPHPRKAAGAQITHSRHGEVVTKNNDTG 359 GE+GF E PE AA Q+ H E V+ ++ TG Sbjct: 6 GETGFSRESAPEIVFSETDMAAAEQLMHLSEEETVSCSSSTG 47 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,748,866 Number of Sequences: 28952 Number of extensions: 262421 Number of successful extensions: 599 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 599 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -