BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0075.Seq (578 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 25 0.35 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 1.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.5 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 3.3 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 3.3 AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 21 5.7 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 25.4 bits (53), Expect = 0.35 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -2 Query: 106 ISHQEISM*REVCYHFFAHVLEILVEK 26 I HQE+ + C F HV+ +L E+ Sbjct: 157 IYHQELEKYEQACNEFTTHVMNLLREQ 183 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.8 bits (49), Expect = 1.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 324 VFPCFNFDIMAQFYVVDVRWNFES*FFLKS 235 VF C+N + FY V + +N F L S Sbjct: 47 VFKCYNLRRIYYFYCVSITFNVHLLFLLCS 76 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/38 (26%), Positives = 22/38 (57%) Frame = +1 Query: 205 NAKSIRPYSSGFEEKSAFKIPPYVDYVKLCHDVEIKTW 318 NAK+ P +G ++A ++ Y ++CH+++ + W Sbjct: 1658 NAKAPGPGQAGEYTRAA----GFLAYYEICHNIKTQGW 1691 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.2 bits (45), Expect = 3.3 Identities = 11/41 (26%), Positives = 16/41 (39%) Frame = -3 Query: 492 HSERQLFVYDTSCGWRNVTSLHRSFNPDSCQEFHVTRGFVN 370 H+ V D GW+N+ S P + FH +N Sbjct: 666 HNPNYAEVTDWYTGWKNMLSDELLAQPTIKENFHTALEIMN 706 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 3.3 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +1 Query: 442 VPPTAACIINKQLSLTMKADRHCMRDRTDPTLSMSAQLAEIRKAT 576 VPP + IIN Q +T ++ + T+ S+ L + K T Sbjct: 409 VPPMQSQIINPQPQITSPSNTNTSTSSTNSNKPNSSDLNMLIKET 453 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 489 YES*QTLYERSDRPYAFN 542 Y+ + +++ SDRP FN Sbjct: 23 YQELRDIFQDSDRPITFN 40 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,007 Number of Sequences: 336 Number of extensions: 3052 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -