BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0074.Seq (603 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30590.1 68414.m03742 RNA polymerase I specific transcription... 30 1.0 >At1g30590.1 68414.m03742 RNA polymerase I specific transcription initiation factor RRN3 family protein weak similarity to RNA polymerase I transcription factor RRN3 [Homo sapiens] GI:7670100; contains Pfam profile PF05327: RNA polymerase I specific transcription initiation factor RRN3 Length = 604 Score = 30.3 bits (65), Expect = 1.0 Identities = 19/73 (26%), Positives = 34/73 (46%) Frame = -2 Query: 281 NNVKRLFVIILYNIRNYVISIY*YVFSSYLHYVYYSID*LFLK*KEICILGTIYSILKTC 102 + + +F I+ + NY+++ Y FS +L + S+D + L IY TC Sbjct: 297 DRLDEVFEILFKSFENYILNTYKTKFSQFLMFYACSLDPENCGVRFASKLLDIYLSSNTC 356 Query: 101 VFEKLSTDAYLGN 63 ++S AYL + Sbjct: 357 RLTRMSAVAYLAS 369 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,462,824 Number of Sequences: 28952 Number of extensions: 177901 Number of successful extensions: 290 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 290 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -