BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0073.Seq (538 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC800.10c |||EPS15 repeat family actin cortical patch componen... 26 3.1 >SPBC800.10c |||EPS15 repeat family actin cortical patch component |Schizosaccharomyces pombe|chr 2|||Manual Length = 1116 Score = 26.2 bits (55), Expect = 3.1 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +3 Query: 81 TSAMPGAEPSRCLPLNTLHKPRLKKDMS*RSGNTVEGSSFHSRMVRG 221 TS++P S NTL P L + S +TV + FH+ + G Sbjct: 740 TSSVPTQHNSFDAMHNTLRSPSLNSNNSSAHASTVSRNPFHNLKISG 786 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,915,038 Number of Sequences: 5004 Number of extensions: 33139 Number of successful extensions: 63 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 222442660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -