Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0073.Seq
         (538 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC800.10c |||EPS15 repeat family actin cortical patch componen...    26   3.1  

>SPBC800.10c |||EPS15 repeat family actin cortical patch component
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1116

 Score = 26.2 bits (55), Expect = 3.1
 Identities = 15/47 (31%), Positives = 22/47 (46%)
 Frame = +3

Query: 81  TSAMPGAEPSRCLPLNTLHKPRLKKDMS*RSGNTVEGSSFHSRMVRG 221
           TS++P    S     NTL  P L  + S    +TV  + FH+  + G
Sbjct: 740 TSSVPTQHNSFDAMHNTLRSPSLNSNNSSAHASTVSRNPFHNLKISG 786


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,915,038
Number of Sequences: 5004
Number of extensions: 33139
Number of successful extensions: 63
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 63
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 63
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 222442660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)