BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0063.Seq (528 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021387-1|CAE17853.1| 187|Caenorhabditis elegans Hypothetical ... 28 3.6 U41279-12|AAK31419.1| 110|Caenorhabditis elegans Hypothetical p... 27 8.3 >AL021387-1|CAE17853.1| 187|Caenorhabditis elegans Hypothetical protein H01A20.2 protein. Length = 187 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 88 NHLKVNIKDS*VSHRTSLSKDSIKLSNRLR 177 N LK I D ++H + +KD + NRLR Sbjct: 123 NQLKATIDDEIIAHLGAFAKDDVITENRLR 152 >U41279-12|AAK31419.1| 110|Caenorhabditis elegans Hypothetical protein C17C3.5 protein. Length = 110 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = +2 Query: 329 SRLKPNINHSSSPKYSSRLKIYNNPLKIKDKYHRSLM*TKGKCL 460 +++KP + P Y + + YN L++++ Y RS++ G + Sbjct: 53 NKIKPEVLKVFHPNYIATDRDYNEMLELRNDYFRSIVYAGGSSI 96 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,779,362 Number of Sequences: 27780 Number of extensions: 58838 Number of successful extensions: 111 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1038911524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -