BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0030.Seq (329 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g51680.2 68414.m05823 4-coumarate--CoA ligase 1 / 4-coumaroyl... 29 0.75 At1g51680.1 68414.m05822 4-coumarate--CoA ligase 1 / 4-coumaroyl... 29 0.75 At3g06670.1 68416.m00786 expressed protein 28 1.7 At5g39210.1 68418.m04749 expressed protein 26 5.3 At5g18530.1 68418.m02191 beige/BEACH domain-containing protein c... 26 5.3 At5g39460.1 68418.m04779 F-box family protein contains Pfam:PF00... 26 7.0 At3g53570.3 68416.m05915 protein kinase (AFC1) (AME2) identical ... 26 7.0 At3g53570.2 68416.m05916 protein kinase (AFC1) (AME2) identical ... 26 7.0 At3g53570.1 68416.m05917 protein kinase (AFC1) (AME2) identical ... 26 7.0 At2g40980.1 68415.m05062 expressed protein 26 7.0 >At1g51680.2 68414.m05823 4-coumarate--CoA ligase 1 / 4-coumaroyl-CoA synthase 1 (4CL1) identical to SP|Q42524 4-coumarate--CoA ligase 1 (EC 6.2.1.12) (4CL 1) (4-coumaroyl-CoA synthase 1) {Arabidopsis thaliana} Length = 490 Score = 29.1 bits (62), Expect = 0.75 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 136 GVLKTCSDDNVALCLKEKALRYVENVSXSXELN-LIDGVSLS 258 GV+ C DDN ++ + E LR+ E + E + +ID V +S Sbjct: 159 GVVIVCIDDNESVPIPEGCLRFTELTQSTTEASEVIDSVEIS 200 >At1g51680.1 68414.m05822 4-coumarate--CoA ligase 1 / 4-coumaroyl-CoA synthase 1 (4CL1) identical to SP|Q42524 4-coumarate--CoA ligase 1 (EC 6.2.1.12) (4CL 1) (4-coumaroyl-CoA synthase 1) {Arabidopsis thaliana} Length = 561 Score = 29.1 bits (62), Expect = 0.75 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 136 GVLKTCSDDNVALCLKEKALRYVENVSXSXELN-LIDGVSLS 258 GV+ C DDN ++ + E LR+ E + E + +ID V +S Sbjct: 159 GVVIVCIDDNESVPIPEGCLRFTELTQSTTEASEVIDSVEIS 200 >At3g06670.1 68416.m00786 expressed protein Length = 865 Score = 27.9 bits (59), Expect = 1.7 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +1 Query: 109 DEDVFRSVMGVLKTCSD-DNV 168 D D FR++MGV K C D +NV Sbjct: 167 DHDFFRNLMGVFKICEDLENV 187 >At5g39210.1 68418.m04749 expressed protein Length = 156 Score = 26.2 bits (55), Expect = 5.3 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 227 SXEXETFSTYRKAFSLRHNATLSSEQVFST 138 S + + F+ K FS RHN +S EQV T Sbjct: 4 SLQKQLFNNGDKLFSSRHNRRVSIEQVHVT 33 >At5g18530.1 68418.m02191 beige/BEACH domain-containing protein contains 5 WD-40 repeats (PF00400); contains Beige/BEACH domain (Pfam PF02138); FACTOR ASSOCIATED WITH N-SMASE ACTIVATION (FAN) (SP:Q92636) Homo sapiens;similar to Lipopolysaccharide-responsive and beige-like anchor protein (CDC4-like protein) (Beige-like protein) (SP:P50851) [Homo sapiens} Length = 909 Score = 26.2 bits (55), Expect = 5.3 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 Query: 145 SALPSLIGRRLRHYSLRPQRILLTPPGASW 56 SAL L G ++ H +RP ILL+ SW Sbjct: 270 SALAHLHGLKVSHGDIRPSNILLSDSLWSW 299 >At5g39460.1 68418.m04779 F-box family protein contains Pfam:PF00646 F-box domain ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 571 Score = 25.8 bits (54), Expect = 7.0 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 208 NVSXSXELNLIDGVSLSVKAXLDQPGPXSLYPT 306 ++ S +NL+D V+ V +D+P +L+PT Sbjct: 206 DLDFSDRMNLLDIVTKHVSLRVDEPLTGNLFPT 238 >At3g53570.3 68416.m05915 protein kinase (AFC1) (AME2) identical to protein kinase AFC1 (EC 2.7.1.-) [Arabidopsis thaliana] Length = 453 Score = 25.8 bits (54), Expect = 7.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -2 Query: 187 FP*DTMRRCHRSKFSALPSLIGRRLRHYSLRPQRILL 77 FP D +R R ++ + RL H L+P+ ILL Sbjct: 198 FPIDLVRELGRQLLESVAYMHDLRLIHTDLKPENILL 234 >At3g53570.2 68416.m05916 protein kinase (AFC1) (AME2) identical to protein kinase AFC1 (EC 2.7.1.-) [Arabidopsis thaliana] Length = 467 Score = 25.8 bits (54), Expect = 7.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -2 Query: 187 FP*DTMRRCHRSKFSALPSLIGRRLRHYSLRPQRILL 77 FP D +R R ++ + RL H L+P+ ILL Sbjct: 212 FPIDLVRELGRQLLESVAYMHDLRLIHTDLKPENILL 248 >At3g53570.1 68416.m05917 protein kinase (AFC1) (AME2) identical to protein kinase AFC1 (EC 2.7.1.-) [Arabidopsis thaliana] Length = 467 Score = 25.8 bits (54), Expect = 7.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -2 Query: 187 FP*DTMRRCHRSKFSALPSLIGRRLRHYSLRPQRILL 77 FP D +R R ++ + RL H L+P+ ILL Sbjct: 212 FPIDLVRELGRQLLESVAYMHDLRLIHTDLKPENILL 248 >At2g40980.1 68415.m05062 expressed protein Length = 617 Score = 25.8 bits (54), Expect = 7.0 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -2 Query: 184 P*DTMRRCHRSKFSALPSLIGRRLRHYSLRPQRILLTPPG 65 P + +R CH SAL S +RH +RP+ ++ G Sbjct: 445 PEEAIRCCHDC-LSALSSSSSAGIRHGDIRPENVVYVTSG 483 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.312 0.131 0.364 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,555,812 Number of Sequences: 28952 Number of extensions: 105051 Number of successful extensions: 155 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 155 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 380568784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -