BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0028.Seq (329 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 4.4 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 4.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 20 5.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 20 5.8 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 20 7.7 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 20.6 bits (41), Expect = 4.4 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = +2 Query: 101 SPSDKGISELVLFHRPRCPSTRKNWCN 181 +PS++ + EL R C +W N Sbjct: 295 NPSERVMRELGRIFRAYCRENHASWVN 321 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 20.6 bits (41), Expect = 4.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 222 GGRDEGSDGNRVXLSNEER 278 GGR G DG+R EE+ Sbjct: 93 GGRGGGRDGDRGDGGGEEK 111 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.2 bits (40), Expect = 5.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +1 Query: 187 KLAEQAERYDDMAAAMKEVTETGSNLATRRG 279 KL Y+D E+ +T SNLA G Sbjct: 1350 KLKGINNEYEDQTEVPVEMRKTVSNLAQTSG 1380 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.2 bits (40), Expect = 5.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +1 Query: 187 KLAEQAERYDDMAAAMKEVTETGSNLATRRG 279 KL Y+D E+ +T SNLA G Sbjct: 1350 KLKGINNEYEDQTEVPVEMRKTVSNLAQTSG 1380 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 19.8 bits (39), Expect = 7.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 222 GGRDEGSDGN 251 GG D G DGN Sbjct: 102 GGEDIGDDGN 111 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,401 Number of Sequences: 336 Number of extensions: 1355 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6367260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -