BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0027.Seq (279 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 44 7e-04 UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 40 0.011 UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lu... 36 0.23 UniRef50_UPI0000F1F069 Cluster: PREDICTED: hypothetical protein;... 32 2.1 UniRef50_Q7RAM4 Cluster: Putative uncharacterized protein PY0647... 31 5.0 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 44.0 bits (99), Expect = 7e-04 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +1 Query: 79 GKCFR*CSSCDDPRISPLTSQYECPQ 156 GKCFR C S ++ RISPLTS+Y+CPQ Sbjct: 259 GKCFRSCLSPENLRISPLTSEYKCPQ 284 >UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Nematostella vectensis Length = 79 Score = 39.9 bits (89), Expect = 0.011 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -3 Query: 70 FHQSRTKVRGSKAIRYRPSSNRK 2 F RTKVRGSK IRYRPSSN K Sbjct: 6 FRCQRTKVRGSKTIRYRPSSNHK 28 >UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 72 Score = 35.5 bits (78), Expect = 0.23 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -3 Query: 70 FHQSRTKVRGSKAIRYRPSSNRK 2 FH RTKV GSK IRY PS N K Sbjct: 6 FHCQRTKVGGSKMIRYHPSLNHK 28 >UniRef50_UPI0000F1F069 Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 389 Score = 32.3 bits (70), Expect = 2.1 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +3 Query: 90 SLMFVLRRSKNFTSNVAIRMPPVIPINHYLG 182 S+M V+ RS FT IR+PP+ I+H+LG Sbjct: 20 SVMGVVERSAVFTRQRDIRLPPIPGISHHLG 50 >UniRef50_Q7RAM4 Cluster: Putative uncharacterized protein PY06475; n=1; Plasmodium yoelii yoelii|Rep: Putative uncharacterized protein PY06475 - Plasmodium yoelii yoelii Length = 24 Score = 31.1 bits (67), Expect = 5.0 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -3 Query: 130 EVKFLDRRKTNISESICQRCFH 65 EVKFLD +TN ESIC + FH Sbjct: 3 EVKFLDFLETNNCESICLKYFH 24 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 243,552,792 Number of Sequences: 1657284 Number of extensions: 3839747 Number of successful extensions: 9646 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9646 length of database: 575,637,011 effective HSP length: 70 effective length of database: 459,627,131 effective search space used: 10111796882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -