BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0025.Seq (439 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 25 0.42 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 3.9 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 24.6 bits (51), Expect = 0.42 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +2 Query: 233 IFTYTQHALRIGKIRAKHTHSAKNK*Q*YWNCRRLRNERF*KKNSSRTH 379 I TY+ H L+ G + H + + Q Y + + +RF +N + H Sbjct: 72 IVTYSGHKLKAGSMVHLHIYDMHHNPQVYPDPEKFDPDRFLPENCLKRH 120 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.4 bits (43), Expect = 3.9 Identities = 7/20 (35%), Positives = 12/20 (60%), Gaps = 3/20 (15%) Frame = -3 Query: 155 CYRSGTV---CWDVNVKLYC 105 C+ T+ CW + V++YC Sbjct: 48 CFLLSTILGTCWIIYVRIYC 67 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,044 Number of Sequences: 336 Number of extensions: 2287 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9775509 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -