BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0025.Seq (439 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0534 + 30057933-30058290,30058472-30059454 27 6.6 >01_06_0534 + 30057933-30058290,30058472-30059454 Length = 446 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 71 KTLELLHRMLLYSKALHSRPSTRCQTDNKTL 163 + L+ LHRMLL KA+ +RC T+ L Sbjct: 34 ENLQQLHRMLLRIKAVVEEADSRCITNQAML 64 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,585,272 Number of Sequences: 37544 Number of extensions: 203788 Number of successful extensions: 399 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 399 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 823860276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -