BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0024.Seq (368 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19460.1 68416.m02467 reticulon family protein (RTNLB11) weak... 31 0.24 At4g23630.1 68417.m03403 reticulon family protein (RTNLB1) weak ... 26 6.8 At3g60600.1 68416.m06781 vesicle-associated membrane protein, pu... 26 6.8 At5g41600.1 68418.m05054 reticulon family protein (RTNLB4) weak ... 26 9.0 At3g10260.3 68416.m01230 reticulon family protein weak similarit... 26 9.0 At3g10260.2 68416.m01229 reticulon family protein weak similarit... 26 9.0 At3g10260.1 68416.m01228 reticulon family protein weak similarit... 26 9.0 At2g15280.1 68415.m01742 reticulon family protein (RTNLB10) low ... 26 9.0 >At3g19460.1 68416.m02467 reticulon family protein (RTNLB11) weak similarity to neuroendocrine-specific protein C [Homo sapiens] GI:307311; identical to cDNA RTNLB11 GI:32331878 Length = 200 Score = 31.1 bits (67), Expect = 0.24 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 338 LKXGVLLWCLTYVGACFNGITLIILG 261 L+ ++LW ++YVG N +TL+ +G Sbjct: 128 LQVSLVLWAISYVGTLINSLTLVYIG 153 >At4g23630.1 68417.m03403 reticulon family protein (RTNLB1) weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon Length = 275 Score = 26.2 bits (55), Expect = 6.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 320 LWCLTYVGACFNGITLIILGWI 255 LW L+ +G CFN +TL + + Sbjct: 201 LWVLSILGGCFNFLTLAYIALV 222 Score = 26.2 bits (55), Expect = 6.8 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Frame = -3 Query: 252 LFTLPKAYEMNKAQVDANLELARAKINE----ITAKVRAAVPLGRRAEGDKD 109 LFT+P AY+ + +VD E A ++ + + KV + +PLG KD Sbjct: 224 LFTVPLAYDKYEDKVDPLGEKAMIELKKQYAVLDEKVLSKIPLGPLKNKKKD 275 >At3g60600.1 68416.m06781 vesicle-associated membrane protein, putative / VAMP, putative similar to VAP27 GI:6688926 [Nicotiana plumbaginifolia] Length = 256 Score = 26.2 bits (55), Expect = 6.8 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 222 NKAQVDANLELARAKINEITAKVRAAVPLGRRAEGDKDK 106 NKA N ARA I ++T + ++A+ L R + + D+ Sbjct: 183 NKAGHQENTSEARALITKLTEEKQSAIQLNNRLQRELDQ 221 >At5g41600.1 68418.m05054 reticulon family protein (RTNLB4) weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251, SP|O95197 Reticulon protein 3 (Neuroendocrine-specific protein-like) {Homo sapiens}; contains Pfam profile PF02453: Reticulon Length = 257 Score = 25.8 bits (54), Expect = 9.0 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -1 Query: 320 LWCLTYVGACFNGITL 273 LW L+ +G+C+N +TL Sbjct: 180 LWVLSIIGSCYNFLTL 195 >At3g10260.3 68416.m01230 reticulon family protein weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon; identical to cDNA GI:32331854 Length = 267 Score = 25.8 bits (54), Expect = 9.0 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -1 Query: 320 LWCLTYVGACFNGITLIILGWI 255 LW VG+C N +T++ +G++ Sbjct: 193 LWVAAMVGSCCNFLTVLYIGFV 214 >At3g10260.2 68416.m01229 reticulon family protein weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon; identical to cDNA GI:32331854 Length = 247 Score = 25.8 bits (54), Expect = 9.0 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -1 Query: 320 LWCLTYVGACFNGITLIILGWI 255 LW VG+C N +T++ +G++ Sbjct: 173 LWVAAMVGSCCNFLTVLYIGFV 194 >At3g10260.1 68416.m01228 reticulon family protein weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon; identical to cDNA GI:32331854 Length = 247 Score = 25.8 bits (54), Expect = 9.0 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -1 Query: 320 LWCLTYVGACFNGITLIILGWI 255 LW VG+C N +T++ +G++ Sbjct: 173 LWVAAMVGSCCNFLTVLYIGFV 194 >At2g15280.1 68415.m01742 reticulon family protein (RTNLB10) low similarity to neuroendocrine-specific protein C [Homo sapiens] GI:307311, SP|Q64548 Reticulon 1 (Neuroendocrine-specific protein) {Rattus norvegicus}; contains Pfam profile PF02453: Reticulon Length = 201 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -1 Query: 335 KXGVLLWCLTYVGACFNGITLIILG 261 + V+LW +++VG N +T++ LG Sbjct: 121 RVSVVLWTVSFVGNFLNFLTILYLG 145 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,592,288 Number of Sequences: 28952 Number of extensions: 50000 Number of successful extensions: 184 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 181 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 184 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 487896136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -