BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0023.Seq (379 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) 107 4e-24 SB_5591| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_8887| Best HMM Match : G-patch (HMM E-Value=1.2e-08) 29 1.7 SB_7527| Best HMM Match : DSL (HMM E-Value=2.5e-34) 29 1.7 SB_2761| Best HMM Match : zf-TRAF (HMM E-Value=0.26) 29 1.7 SB_8320| Best HMM Match : p450 (HMM E-Value=0) 27 5.1 SB_13477| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 27 6.7 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_20921| Best HMM Match : WD40 (HMM E-Value=8.9) 26 8.8 SB_18995| Best HMM Match : rve (HMM E-Value=0.0012) 26 8.8 >SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) Length = 147 Score = 107 bits (256), Expect = 4e-24 Identities = 62/128 (48%), Positives = 82/128 (64%), Gaps = 6/128 (4%) Frame = -3 Query: 371 CIGFTNKDSLSQRKTCYGPAHSGQSNQKENV*NHYTRR-HNSELREVVNKLIPDSIAKDI 195 CIGFT + +KT Y ++ +K+ V + TR ++L+EVVNKLIPDSI KDI Sbjct: 22 CIGFTKRRQNQIKKTAYAKHTQIKAIRKKMV-DIITREVSTNDLKEVVNKLIPDSIGKDI 80 Query: 194 EKACHGIYPLRDVCIRKVKVLKRPRFEISKLMELH-----XXXXXXXXXXGDKSERPEGY 30 EK+C IYPL DV IRKVKVLK+P+F+I KLME+H G K +R EG+ Sbjct: 81 EKSCQSIYPLHDVHIRKVKVLKKPKFDIGKLMEMHGEASSHATTTTTDETGTKIDR-EGF 139 Query: 29 EPPVQESV 6 EPP+Q++V Sbjct: 140 EPPIQDTV 147 >SB_5591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1038 Score = 29.1 bits (62), Expect = 1.3 Identities = 18/46 (39%), Positives = 21/46 (45%) Frame = +2 Query: 137 LSPFGCKHRAEGRCHGRPSRCPWQWSQESTCSPPP*VQSCDVACND 274 L P GC R G S P + +Q STC P V S D+ ND Sbjct: 457 LQPGGCDSRISGGRRKGSSSAPPRGAQRSTCRPG--VCSVDLPSND 500 >SB_8887| Best HMM Match : G-patch (HMM E-Value=1.2e-08) Length = 739 Score = 28.7 bits (61), Expect = 1.7 Identities = 13/53 (24%), Positives = 27/53 (50%) Frame = -3 Query: 260 RHNSELREVVNKLIPDSIAKDIEKACHGIYPLRDVCIRKVKVLKRPRFEISKL 102 RHN EL E++ + + A ++ K + L +C+ K ++ + E+ K+ Sbjct: 67 RHNVELPEILCDVAETAFANEVTKGFFRVRALIRICVTKTQMEIQNALEVVKI 119 >SB_7527| Best HMM Match : DSL (HMM E-Value=2.5e-34) Length = 542 Score = 28.7 bits (61), Expect = 1.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 362 FTNKDSLSQRKTCYGPAHSGQSNQKENV*NHYT 264 F S+ K YGP S + QK+N+ HYT Sbjct: 228 FRTSFSVQCNKNYYGPECSMKCQQKDNIEGHYT 260 >SB_2761| Best HMM Match : zf-TRAF (HMM E-Value=0.26) Length = 436 Score = 28.7 bits (61), Expect = 1.7 Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 7/43 (16%) Frame = +2 Query: 170 GRCHGRPSRCPWQWSQESTCSPP-------P*VQSCDVACNDF 277 G+C G P+ PW PP P + SCD C DF Sbjct: 50 GQCRG-PNNTPWNKQTYKLSLPPASKPVHAPVILSCDACCRDF 91 >SB_8320| Best HMM Match : p450 (HMM E-Value=0) Length = 1207 Score = 27.1 bits (57), Expect = 5.1 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +2 Query: 185 RPSRCPWQWSQESTCSPPP*VQSCDVACNDF 277 RP R P++W + +PPP + ++ C+++ Sbjct: 583 RPQRRPYRWKRAKPTTPPP-CKDINLKCDEW 612 >SB_13477| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 628 Score = 26.6 bits (56), Expect = 6.7 Identities = 19/61 (31%), Positives = 24/61 (39%), Gaps = 9/61 (14%) Frame = +2 Query: 101 STSRSRNGASSTLSPFGCKHR----AEGRCHGRPSRCPWQ-----WSQESTCSPPP*VQS 253 S S N ++ P C + A RC RC Q WS E+ CS PP + Sbjct: 132 SDEMSCNATATPFVPRSCHYWEFQCANRRCVYNSQRCDGQNDCGDWSDETGCSTPPIPTT 191 Query: 254 C 256 C Sbjct: 192 C 192 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 26.2 bits (55), Expect = 8.8 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -2 Query: 207 CQGHREGLP-WHLPSARCLHPKGESVEEAPFR 115 C G E L HLP +C+ K E+ PFR Sbjct: 339 CCGSEESLMLMHLPLQKCIGKKDLGSEQRPFR 370 >SB_20921| Best HMM Match : WD40 (HMM E-Value=8.9) Length = 101 Score = 26.2 bits (55), Expect = 8.8 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +3 Query: 15 LNGRLVA-LRPFRLVSGFPLASTAFAVKFHQLRDLETGPLQHFHL-SDANI 161 +NGR VA P L+ F +K + LR + GP FH+ +D NI Sbjct: 5 VNGRPVAAFDPEGLI--FAAGIDCEMIKLYDLRSFDKGPFSTFHIQTDPNI 53 >SB_18995| Best HMM Match : rve (HMM E-Value=0.0012) Length = 1225 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 95 VPSTSRSRNGASSTLSPFGC 154 VP+TSRS + AS +L+ GC Sbjct: 814 VPATSRSGDSASRSLTNLGC 833 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,057,098 Number of Sequences: 59808 Number of extensions: 220642 Number of successful extensions: 612 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 609 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 632178915 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -