BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0023.Seq (379 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34670.1 68417.m04922 40S ribosomal protein S3A (RPS3aB) 84 3e-17 At3g04840.1 68416.m00525 40S ribosomal protein S3A (RPS3aA) simi... 83 4e-17 At1g78700.1 68414.m09173 brassinosteroid signalling positive reg... 27 3.1 At5g38550.1 68418.m04661 jacalin lectin family protein similar t... 27 4.1 At5g44290.1 68418.m05421 protein kinase family protein contains ... 27 5.5 At1g54570.1 68414.m06223 esterase/lipase/thioesterase family pro... 27 5.5 At5g28080.1 68418.m03391 protein kinase family protein contains ... 26 7.2 At4g36390.1 68417.m05170 radical SAM domain-containing protein /... 26 7.2 At1g79830.1 68414.m09326 expressed protein weak similarity to TA... 26 7.2 At1g60130.1 68414.m06774 jacalin lectin family protein similar t... 26 9.6 At3g17630.1 68416.m02252 cation/hydrogen exchanger, putative (CH... 23 9.9 >At4g34670.1 68417.m04922 40S ribosomal protein S3A (RPS3aB) Length = 262 Score = 84.2 bits (199), Expect = 3e-17 Identities = 43/96 (44%), Positives = 63/96 (65%), Gaps = 2/96 (2%) Frame = -3 Query: 371 CIGFTNKDSLSQRKTCYGPAHSGQSNQKENV*NHYTRRHNS--ELREVVNKLIPDSIAKD 198 CI FT + + ++TCY A S Q Q + + S +L+E+V K IP++I ++ Sbjct: 139 CIAFTKRRANQVKRTCY--AQSSQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGRE 196 Query: 197 IEKACHGIYPLRDVCIRKVKVLKRPRFEISKLMELH 90 IEKA GIYPL++V IRKVK+LK P+F++ KLME+H Sbjct: 197 IEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEVH 232 >At3g04840.1 68416.m00525 40S ribosomal protein S3A (RPS3aA) similar to 40S ribosomal protein S3A (S phase specific protein GBIS289) GB:P49396 [Brassica rapa] Length = 262 Score = 83.4 bits (197), Expect = 4e-17 Identities = 42/96 (43%), Positives = 66/96 (68%), Gaps = 2/96 (2%) Frame = -3 Query: 371 CIGFTNKDSLSQRKTCYGPAHSGQSNQ-KENV*NHYTRRHNS-ELREVVNKLIPDSIAKD 198 CI FT + + ++TCY A S Q Q + + + R +S +L+++V K IP++I ++ Sbjct: 139 CIAFTKRRANQVKRTCY--AQSSQIRQIRRKMRDIMVREASSCDLKDLVAKFIPEAIGRE 196 Query: 197 IEKACHGIYPLRDVCIRKVKVLKRPRFEISKLMELH 90 IEKA GIYPL++V IRKVK+LK P+F++ KLM++H Sbjct: 197 IEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMDVH 232 >At1g78700.1 68414.m09173 brassinosteroid signalling positive regulator-related contains similarity to BZR1 protein [Arabidopsis thaliana] gi|20270971|gb|AAM18490 Length = 325 Score = 27.5 bits (58), Expect = 3.1 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 140 SPFGCKHRAEGRCHGRPSRCPWQWSQESTCSP--PP*V-QSCDVACND 274 +PFG K A G W Q TCSP PP Q+ DV ++ Sbjct: 234 NPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAIPPGADQTADVPMSE 281 >At5g38550.1 68418.m04661 jacalin lectin family protein similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin domain Length = 594 Score = 27.1 bits (57), Expect = 4.1 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 213 LHCQGHREGLPW 178 L CQG R+GLPW Sbjct: 299 LECQGDRKGLPW 310 >At5g44290.1 68418.m05421 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 644 Score = 26.6 bits (56), Expect = 5.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 176 IYPLRDVCIRKVKVLKRPRFEISKL 102 +Y RD+ K+ LKR RF++S L Sbjct: 151 VYKARDLTNNKIVALKRVRFDLSDL 175 >At1g54570.1 68414.m06223 esterase/lipase/thioesterase family protein contains Interpro entry IPR000379 Length = 704 Score = 26.6 bits (56), Expect = 5.5 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +3 Query: 54 VSGFPLASTAFAVKFHQLRDLETGPLQHFHLSDANIAQR 170 ++G P V +H L LE GP+ + + NI R Sbjct: 438 LAGVPDKGPVLLVGYHMLMGLELGPMSEAFIKEKNILFR 476 >At5g28080.1 68418.m03391 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 406 Score = 26.2 bits (55), Expect = 7.2 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 135 HFHLSDANIAQRVDAMAGLLDVLGNGVRNQLVHHLPEF 248 HF D + +RV++ GL+D G +R+ +H+P + Sbjct: 194 HFLCIDESDMRRVESEKGLIDEAGTPLRHS--YHIPHY 229 >At4g36390.1 68417.m05170 radical SAM domain-containing protein / TRAM domain-containing protein similar to CDK5 activator-binding protein [Rattus norvegicus] GI:7330738; contains Pfam profiles PF00919: UPF0004 family protein, PF01938: TRAM domain, PF04055: radical SAM domain protein Length = 640 Score = 26.2 bits (55), Expect = 7.2 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -3 Query: 317 PAHSGQSNQKENV*NHYTRRHNSELREVVNKLIPD 213 PA SG S E + YTR +L + + +IPD Sbjct: 424 PAQSGNSRILEQMRRGYTREAYLDLVKKIRSIIPD 458 >At1g79830.1 68414.m09326 expressed protein weak similarity to TATA element modulatory factor (TMF) (Swiss-Prot:P82094) [Homo sapiens] Length = 927 Score = 26.2 bits (55), Expect = 7.2 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -3 Query: 305 GQSNQKENV*NHYTRRHNSELREVVNKLIPDSIAKDIEK 189 G++NQ E R+H EL+EV+ L + I KD+E+ Sbjct: 727 GRANQLEVEIRELRRKHKQELQEVL--LHNELIQKDLER 763 >At1g60130.1 68414.m06774 jacalin lectin family protein similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin domain Length = 600 Score = 25.8 bits (54), Expect = 9.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 371 CIGFTNKDSLSQRKTCYGPAH 309 CI + D + RK YGPAH Sbjct: 195 CIQYIKFDYVKDRKYIYGPAH 215 >At3g17630.1 68416.m02252 cation/hydrogen exchanger, putative (CHX19) similar to putative Na+/H+-exchanging protein GB:CAA23036 from [Arabidopsis thaliana]; monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 857 Score = 23.0 bits (47), Expect(2) = 9.9 Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +3 Query: 99 HQLRDLETGPLQH-FHLSDANIAQRVDAMAGLLDVLGNGVRNQLVHHLPEFRVV 257 HQ D + H FH + + QR G+L G G +Q+V ++VV Sbjct: 631 HQRMDGAMESIGHRFHEVNQRVLQRAPCSVGILVDRGLGGTSQVVASEVAYKVV 684 Score = 21.0 bits (42), Expect(2) = 9.9 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = +3 Query: 24 RLVALRPFRLVSGFPLASTAFAVKFHQLR 110 R VA+RP +SG HQ R Sbjct: 592 RAVAVRPMTAISGLSSIHEDICTSAHQKR 620 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,631,898 Number of Sequences: 28952 Number of extensions: 146871 Number of successful extensions: 464 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 517767328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -