BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0022.Seq (499 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 1.5 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 21 6.2 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.0 bits (47), Expect = 1.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 47 LLIFCRFPQCFGHFLIC*IF*FL*FVIM 130 LL +C F HFL+C + + F+I+ Sbjct: 83 LLFYCPFIIFTVHFLLCTYYFYYAFIIL 110 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/42 (23%), Positives = 22/42 (52%) Frame = -2 Query: 294 YKTVKHNQXVMIHLIVLYLKTFHDG*FTMSLYLHLKNL*DKS 169 Y+TV H V + + +TF F + +++ ++++ D S Sbjct: 173 YETVAHGMTVQKTTLFFFNRTFGVPIFLVLVFVQMQSVQDLS 214 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,607 Number of Sequences: 336 Number of extensions: 1819 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -