BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0021.Seq (409 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 4e-04 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 8e-04 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 32 0.21 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 32 0.21 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.63 SB_24480| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_21457| Best HMM Match : efhand (HMM E-Value=1.7e-29) 27 7.8 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 40.7 bits (91), Expect = 4e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 2 PVVICLSQRLSHACLSASRIKAIPRMA 82 PVVICLSQRLSHACLS S RMA Sbjct: 135 PVVICLSQRLSHACLSISTCTVKLRMA 161 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.9 bits (89), Expect = 8e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 2 PVVICLSQRLSHACLSASRIKAIPRMA 82 PVVICLSQRLSHACLS S RMA Sbjct: 111 PVVICLSQRLSHACLSISTRTVKLRMA 137 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 31.9 bits (69), Expect = 0.21 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 447 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 491 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 31.9 bits (69), Expect = 0.21 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 866 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 910 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 30.3 bits (65), Expect = 0.63 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 407 FLRLPXRNRTLIPRYP 360 FLRLP RNRTLI R+P Sbjct: 225 FLRLPLRNRTLILRHP 240 >SB_24480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 27.1 bits (57), Expect = 5.9 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +1 Query: 67 DTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSDG 183 D NG+I F + W + LE IH + TL DG Sbjct: 263 DFGNGTISSFTGNITRFNVWTLYISLEFIHNMATLVEDG 301 >SB_21457| Best HMM Match : efhand (HMM E-Value=1.7e-29) Length = 420 Score = 26.6 bits (56), Expect = 7.8 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 28 IKPCMSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIR-TLTSDGMSAFIRS 204 +KPC S P + +++ +VT+ V + IH R TL+SD M A S Sbjct: 35 LKPCSSNYAP---SEQSYNVFLAPLYTRATVTYKGPVQSQGIHLNRYTLSSDNMKANNIS 91 Query: 205 KPIDG 219 +P+DG Sbjct: 92 RPLDG 96 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,331,329 Number of Sequences: 59808 Number of extensions: 192353 Number of successful extensions: 468 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 740151420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -