BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0021.Seq (409 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051711-1|AAK93135.1| 585|Drosophila melanogaster LD24837p pro... 28 5.4 AE014296-1997|AAN11879.1| 585|Drosophila melanogaster CG11660-P... 28 5.4 AE014296-1996|AAF50033.1| 585|Drosophila melanogaster CG11660-P... 28 5.4 >AY051711-1|AAK93135.1| 585|Drosophila melanogaster LD24837p protein. Length = 585 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 361 RDNHGSRRNYHRKLIRQTFERCXRRYLTMRSAKV 260 R HG ++ RK++R E+ R YL MR+A V Sbjct: 253 RFRHGYCKHNPRKMVRTWAEKEMRNYLRMRNAGV 286 >AE014296-1997|AAN11879.1| 585|Drosophila melanogaster CG11660-PB, isoform B protein. Length = 585 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 361 RDNHGSRRNYHRKLIRQTFERCXRRYLTMRSAKV 260 R HG ++ RK++R E+ R YL MR+A V Sbjct: 253 RFRHGYCKHNPRKMVRTWAEKEMRNYLRMRNAGV 286 >AE014296-1996|AAF50033.1| 585|Drosophila melanogaster CG11660-PA, isoform A protein. Length = 585 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 361 RDNHGSRRNYHRKLIRQTFERCXRRYLTMRSAKV 260 R HG ++ RK++R E+ R YL MR+A V Sbjct: 253 RFRHGYCKHNPRKMVRTWAEKEMRNYLRMRNAGV 286 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,072,729 Number of Sequences: 53049 Number of extensions: 281230 Number of successful extensions: 706 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1188481122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -