BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0020.Seq (370 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F12.07 |||phosphoserine aminotransferase |Schizosaccharomyc... 38 7e-04 SPAC3G6.11 |||ATP-dependent DNA helicase Chl1|Schizosaccharomyce... 27 1.2 SPAC4A8.10 |||lipase |Schizosaccharomyces pombe|chr 1|||Manual 25 4.9 SPAC4G9.05 |mpf1||meiotic PUF family protein 1|Schizosaccharomyc... 24 6.5 SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 24 6.5 SPBC1826.01c |mot1||TATA-binding protein associated factor Mot1|... 24 6.5 SPAC6G9.08 |ubp6||ubiquitin C-terminal hydrolase Ubp6|Schizosacc... 24 8.6 >SPAC1F12.07 |||phosphoserine aminotransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 389 Score = 37.5 bits (83), Expect = 7e-04 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +2 Query: 110 KVFNFGAGPAKLPEEVYEIIKNELTNFENSGISLLETSHRS 232 +V NF AGPA + V E + NF+ G+ + E SHRS Sbjct: 6 EVVNFAAGPAAMITSVVEEFGKDFVNFQGLGMGVAEISHRS 46 >SPAC3G6.11 |||ATP-dependent DNA helicase Chl1|Schizosaccharomyces pombe|chr 1|||Manual Length = 844 Score = 26.6 bits (56), Expect = 1.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 364 LSLKEQLQIDQDPHQLXTALCSCPVHLISFAQ 269 L+LK+ + I + H L A+CS ISF Q Sbjct: 352 LTLKDNICIIDEAHNLIDAICSMHSSSISFRQ 383 >SPAC4A8.10 |||lipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 723 Score = 24.6 bits (51), Expect = 4.9 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 111 LDIFTYLFI*LIPTLHYFTKRH 46 ++ FT LFI +PT YF K H Sbjct: 581 VNTFTNLFIPAVPTDSYFFKYH 602 >SPAC4G9.05 |mpf1||meiotic PUF family protein 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 581 Score = 24.2 bits (50), Expect = 6.5 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 254 HLASCMLKNDDLFPIN 207 +L +C LKN D FP++ Sbjct: 116 YLTNCNLKNKDTFPVS 131 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 24.2 bits (50), Expect = 6.5 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -1 Query: 223 TCFQ*TNSRIFKICQFILNNFIDFFWQ 143 TCF T S+ + CQ +LN +F++Q Sbjct: 1379 TCFFVTRSKKYPYCQVVLNE-PNFYFQ 1404 >SPBC1826.01c |mot1||TATA-binding protein associated factor Mot1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1953 Score = 24.2 bits (50), Expect = 6.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 140 KLPEEVYEIIKNELTNFENSGISLLETSHRSSTYMKL 250 KLP+++ IIK + + + S L+ H +S MKL Sbjct: 991 KLPKKLNSIIKGIMESIKKEQFSCLQ-MHSASAMMKL 1026 >SPAC6G9.08 |ubp6||ubiquitin C-terminal hydrolase Ubp6|Schizosaccharomyces pombe|chr 1|||Manual Length = 467 Score = 23.8 bits (49), Expect = 8.6 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -1 Query: 202 SRIFKICQFILNNFIDFFWQFS 137 SRI ++ ++ NF+ F+W+ S Sbjct: 278 SRISRLPNYLTVNFVRFYWKAS 299 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,326,605 Number of Sequences: 5004 Number of extensions: 23460 Number of successful extensions: 81 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 116121426 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -