BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0019.Seq (451 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0551 + 4446937-4447353,4449141-4450013,4451206-4451244,445... 29 2.3 07_01_0589 - 4381188-4381433,4381509-4381604,4381673-4381858,438... 27 9.2 >12_01_0551 + 4446937-4447353,4449141-4450013,4451206-4451244, 4452339-4452581 Length = 523 Score = 28.7 bits (61), Expect = 2.3 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = -2 Query: 396 TXNXAIKDLSSIMAILMSTTARVIKSLLIEEKGLMMYYYYSVLT*CMACRINV 238 T N A KDL +++ ++S T+ IKS +K L M YS+ C+ C + + Sbjct: 214 TNNNARKDLRTLVDGILSRTSIYIKS----DKELDMMNIYSICHTCLNCLVEL 262 >07_01_0589 - 4381188-4381433,4381509-4381604,4381673-4381858, 4382704-4382825,4384127-4384189,4384777-4384930, 4387354-4387381,4387784-4387837,4387950-4388294, 4388382-4388638 Length = 516 Score = 26.6 bits (56), Expect = 9.2 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 287 TTIIQFSLNVWHVE*TCSQCSESAVTYFGFTF*T 186 T +I L V+++ TCS C + A+ FTF T Sbjct: 446 TRMIDEQLLVYYLVSTCSMCGQLALCIHDFTFLT 479 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,586,654 Number of Sequences: 37544 Number of extensions: 131726 Number of successful extensions: 149 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 149 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 871620292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -