BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0019.Seq (451 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY129444-1|AAM76186.1| 671|Drosophila melanogaster LD18443p pro... 29 2.9 AE014296-353|AAF47565.1| 671|Drosophila melanogaster CG13933-PA... 29 2.9 >AY129444-1|AAM76186.1| 671|Drosophila melanogaster LD18443p protein. Length = 671 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = -2 Query: 150 IFLFYMSFKN*RKFNCCNSNSNDFHVCNLSSKRFILQ*LTLINYTYRKKK 1 I LFY++ + FNC S N F+V + SK+ Q + LI+ YR+ + Sbjct: 584 IHLFYLTMHHEPLFNCLKSLHN-FYVAQVPSKK-TEQLIALISSLYRRPR 631 >AE014296-353|AAF47565.1| 671|Drosophila melanogaster CG13933-PA protein. Length = 671 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = -2 Query: 150 IFLFYMSFKN*RKFNCCNSNSNDFHVCNLSSKRFILQ*LTLINYTYRKKK 1 I LFY++ + FNC S N F+V + SK+ Q + LI+ YR+ + Sbjct: 584 IHLFYLTMHHEPLFNCLKSLHN-FYVAQVPSKK-TEQLIALISSLYRRPR 631 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,056,504 Number of Sequences: 53049 Number of extensions: 247869 Number of successful extensions: 552 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1455824790 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -