BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0017.Seq (449 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0924 - 33058194-33058697,33058798-33060147,33060234-330603... 27 7.0 >01_06_0924 - 33058194-33058697,33058798-33060147,33060234-33060303, 33060918-33060976 Length = 660 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +1 Query: 265 HNSGTYPCGPTYYPGTGNYANFENLHAWXLLHTDIPSSWKMSMKALST 408 HN C Y T +YA + D+ ++WK S+KAL T Sbjct: 106 HNVVCLRCAAEYLRMTDDYAEGNLITQAESFLADVLANWKDSIKALET 153 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,112,690 Number of Sequences: 37544 Number of extensions: 140337 Number of successful extensions: 247 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 247 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 871620292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -