BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0016.Seq (398 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 24 0.74 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 22 3.0 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 6.9 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.8 bits (49), Expect = 0.74 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = -2 Query: 226 SRGASLLLQPTDDVISLTTT*IVDRTAIPEEFESRVSSYTVALGEILFLSC 74 ++G L P + LTT ++ + IP+E S YT + +I C Sbjct: 270 AKGGKLACPPAIFIFDLTTDTLIRKYIIPKEQVKEDSLYTNIVVDIRNEDC 320 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 21.8 bits (44), Expect = 3.0 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +3 Query: 273 YXYCIWXLFG 302 Y YC+W FG Sbjct: 72 YMYCLWEQFG 81 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 20.6 bits (41), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +1 Query: 91 SRRELRCTRIPDSQILQEWQSYRLFRWSS 177 SR+ C+R + + + SYR +R +S Sbjct: 268 SRKRYSCSREREQKSYKNENSYRKYRETS 296 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,981 Number of Sequences: 438 Number of extensions: 1393 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -