BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0014.Seq (338 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45236| Best HMM Match : PRP38 (HMM E-Value=0) 27 5.1 SB_33109| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.0 >SB_45236| Best HMM Match : PRP38 (HMM E-Value=0) Length = 381 Score = 26.6 bits (56), Expect = 5.1 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +3 Query: 39 LTNKVQPQYFDTYYFNIKCYYYILLEFSIKLRHYQ 143 LTN +Q YF + +K Y+ ++ E K+ H + Sbjct: 34 LTNILQSPYFKNELYQLKTYHEVVDEIYYKVDHLE 68 >SB_33109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 25.8 bits (54), Expect = 9.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 63 YFDTYYFNIKCYYYILLEFSIKLR 134 Y+ YY+ YYY +LEF ++R Sbjct: 13 YYYYYYYYYYYYYYAILEFRGEVR 36 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,395,916 Number of Sequences: 59808 Number of extensions: 125431 Number of successful extensions: 236 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 236 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 485763447 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -