BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0013.Seq (269 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051520-1|AAK92944.1| 536|Drosophila melanogaster GH17801p pro... 29 0.67 AE014134-281|AAF51348.3| 536|Drosophila melanogaster CG17660-PA... 29 0.67 >AY051520-1|AAK92944.1| 536|Drosophila melanogaster GH17801p protein. Length = 536 Score = 29.5 bits (63), Expect = 0.67 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +3 Query: 96 WAAQPTYIISXAVYVLAGLLTLFHAFKKGGRW--SXFWLGTVL 218 W P Y+I VYV+ G++ LF +F + FW+G V+ Sbjct: 199 WPFLPFYLIMCIVYVIFGIIWLFVSFAQWRDLLRIQFWIGGVI 241 >AE014134-281|AAF51348.3| 536|Drosophila melanogaster CG17660-PA protein. Length = 536 Score = 29.5 bits (63), Expect = 0.67 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +3 Query: 96 WAAQPTYIISXAVYVLAGLLTLFHAFKKGGRW--SXFWLGTVL 218 W P Y+I VYV+ G++ LF +F + FW+G V+ Sbjct: 199 WPFLPFYLIMCIVYVIFGIIWLFVSFAQWRDLLRIQFWIGGVI 241 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,348,084 Number of Sequences: 53049 Number of extensions: 139992 Number of successful extensions: 234 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 234 length of database: 24,988,368 effective HSP length: 68 effective length of database: 21,381,036 effective search space used: 449001756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -