BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0010.Seq (409 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 2.7 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 2.7 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 2.7 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +3 Query: 90 LLFNTLFIQYDTYINPISMTITVR**HINHPDIQKALEVQAPSLPLPSGRMRQP 251 ++FN LF + D PI++T+++ +Q+ + V+ P L +R P Sbjct: 313 IVFNGLFTEEDVADVPINVTLSL---DEKKYILQEVVRVKKPHYELNMVEVRSP 363 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.8 bits (44), Expect = 2.7 Identities = 22/66 (33%), Positives = 30/66 (45%) Frame = -3 Query: 326 PLKDITIGGIVMLNHTGEGEQVLVSRLPHSARRQRKRRSLNLQSLLNIWMIDVLLSNCNC 147 PLKDIT + + G E + +P + RK ++ L ID LLSN Sbjct: 59 PLKDITPPDLEGILDLGRHENFSLF-IP----KHRKVAGKLIRIFLAAESIDDLLSNAVF 113 Query: 146 HRNRVN 129 R+RVN Sbjct: 114 CRDRVN 119 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,991 Number of Sequences: 336 Number of extensions: 1669 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8857716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -