BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0010.Seq (409 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D44466-1|BAA07918.1| 953|Homo sapiens proteasome subunit p112 p... 52 1e-06 BC114434-1|AAI14435.1| 953|Homo sapiens proteasome 26S non-ATPa... 52 1e-06 BC112344-1|AAI12345.1| 953|Homo sapiens proteasome (prosome, ma... 52 1e-06 BC094720-1|AAH94720.1| 953|Homo sapiens proteasome (prosome, ma... 52 1e-06 AC009407-1|AAX93127.1| 953|Homo sapiens unknown protein. 52 1e-06 AK131318-1|BAD18481.1| 276|Homo sapiens protein ( Homo sapiens ... 30 2.6 >D44466-1|BAA07918.1| 953|Homo sapiens proteasome subunit p112 protein. Length = 953 Score = 51.6 bits (118), Expect = 1e-06 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = -3 Query: 407 FEILSNPARVMRQQLKNLTIVEGSGFTPLKDITIGGIVMLNHTGEGEQVLV 255 F++L NPARVM QLK LT+ E + P K ++IGGI++L T E + LV Sbjct: 875 FQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGGIIILKDTSEDIEELV 925 >BC114434-1|AAI14435.1| 953|Homo sapiens proteasome 26S non-ATPase subunit 1 protein. Length = 953 Score = 51.6 bits (118), Expect = 1e-06 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = -3 Query: 407 FEILSNPARVMRQQLKNLTIVEGSGFTPLKDITIGGIVMLNHTGEGEQVLV 255 F++L NPARVM QLK LT+ E + P K ++IGGI++L T E + LV Sbjct: 875 FQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGGIIILKDTSEDIEELV 925 >BC112344-1|AAI12345.1| 953|Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 1 protein. Length = 953 Score = 51.6 bits (118), Expect = 1e-06 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = -3 Query: 407 FEILSNPARVMRQQLKNLTIVEGSGFTPLKDITIGGIVMLNHTGEGEQVLV 255 F++L NPARVM QLK LT+ E + P K ++IGGI++L T E + LV Sbjct: 875 FQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGGIIILKDTSEDIEELV 925 >BC094720-1|AAH94720.1| 953|Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 1 protein. Length = 953 Score = 51.6 bits (118), Expect = 1e-06 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = -3 Query: 407 FEILSNPARVMRQQLKNLTIVEGSGFTPLKDITIGGIVMLNHTGEGEQVLV 255 F++L NPARVM QLK LT+ E + P K ++IGGI++L T E + LV Sbjct: 875 FQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGGIIILKDTSEDIEELV 925 >AC009407-1|AAX93127.1| 953|Homo sapiens unknown protein. Length = 953 Score = 51.6 bits (118), Expect = 1e-06 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = -3 Query: 407 FEILSNPARVMRQQLKNLTIVEGSGFTPLKDITIGGIVMLNHTGEGEQVLV 255 F++L NPARVM QLK LT+ E + P K ++IGGI++L T E + LV Sbjct: 875 FQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGGIIILKDTSEDIEELV 925 >AK131318-1|BAD18481.1| 276|Homo sapiens protein ( Homo sapiens cDNA FLJ16314 fis, clone SPLEN2030847, highly similar to Mus musculus Kif21b (Kif21b) mRNA. ). Length = 276 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 259 RTCSPSPVWFNMTIPPIVISFKGVKPEPS 345 R CSP+P ++ I PI S GV P PS Sbjct: 104 RPCSPTPAESSLDILPISPSLSGVTPVPS 132 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,389,037 Number of Sequences: 237096 Number of extensions: 962737 Number of successful extensions: 5769 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5769 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 3043111070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -