BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0007.Seq (329 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0159 - 13325949-13326839 27 2.7 06_03_1023 - 26952195-26952635,26952723-26952934,26953038-269537... 26 8.3 >01_03_0159 - 13325949-13326839 Length = 296 Score = 27.5 bits (58), Expect = 2.7 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 82 TLGPVPDPLLLNNYRLDIANSNITAQFNNVSVRGLNGNI 198 T P P P + N++RL + + +N+ + G NG + Sbjct: 150 TSSPAPPPAVDNHHRLSPPHDAAGSNYNHPELAGYNGGV 188 >06_03_1023 - 26952195-26952635,26952723-26952934,26953038-26953757, 26955042-26955735 Length = 688 Score = 25.8 bits (54), Expect = 8.3 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 4/34 (11%) Frame = +1 Query: 88 GPVPD--PLL-LNNYR-LDIANSNITAQFNNVSV 177 GP PD PL L R L IAN+N+T F +VS+ Sbjct: 97 GPAPDMAPLAALRGLRALSIANNNLTGPFPDVSM 130 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,704,575 Number of Sequences: 37544 Number of extensions: 123322 Number of successful extensions: 256 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 255 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 256 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 447336660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -