BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0006.Seq (449 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0471 - 17563245-17563488,17563564-17563655,17563941-175640... 31 0.57 05_07_0344 + 29411767-29411961,29412692-29412741,29413295-294134... 29 1.3 02_03_0280 - 17256524-17256733,17256838-17256958,17257318-172574... 29 1.7 09_02_0435 - 9384225-9384412,9385084-9385133,9385209-9385274,938... 29 2.3 06_03_0132 + 17024727-17025265,17025424-17025510,17025617-170256... 27 9.2 04_04_0853 + 28745953-28747635 27 9.2 >08_02_0471 - 17563245-17563488,17563564-17563655,17563941-17564023, 17564418-17564499,17565234-17565461,17565553-17565654, 17565818-17565953,17566080-17566129,17566465-17566572, 17568702-17568911 Length = 444 Score = 30.7 bits (66), Expect = 0.57 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +1 Query: 343 RSDARLEFTGYKKLNETIREIVLYYDN 423 R DA + F G K + E++++ +LYYDN Sbjct: 123 RFDAVVHFAGLKAVGESVQKPLLYYDN 149 >05_07_0344 + 29411767-29411961,29412692-29412741,29413295-29413430, 29413931-29414032,29414153-29414380,29414460-29414544, 29414648-29414730,29414854-29414945,29415048-29415141 Length = 354 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 343 RSDARLEFTGYKKLNETIREIVLYYDN 423 R +A + F G K + E++++ +LYYDN Sbjct: 82 RFEAVIHFAGLKAVGESVQKPLLYYDN 108 >02_03_0280 - 17256524-17256733,17256838-17256958,17257318-17257445, 17257603-17257671,17257757-17257882,17257970-17258235, 17258341-17258535,17258614-17258694,17258729-17258851, 17258941-17259201,17260044-17260130,17260260-17260578 Length = 661 Score = 29.1 bits (62), Expect = 1.7 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 304 DIYETDIKKSVCVRSDARLEFTGYKKLNETIRE 402 D+ E DIKK++ + D R GY++L E ++E Sbjct: 535 DLAELDIKKALEIDPDNRDVKMGYRRLKEKVKE 567 >09_02_0435 - 9384225-9384412,9385084-9385133,9385209-9385274, 9385360-9385451,9385893-9385975,9386181-9386259, 9386888-9387115,9387196-9387297,9387719-9387854, 9387984-9388033,9389391-9389618 Length = 433 Score = 28.7 bits (61), Expect = 2.3 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 343 RSDARLEFTGYKKLNETIREIVLYYDN 423 R DA + F G K + E++++ +LYYD+ Sbjct: 93 RFDAVVHFAGLKAVGESVQKPLLYYDH 119 >06_03_0132 + 17024727-17025265,17025424-17025510,17025617-17025673, 17028754-17028992,17029161-17029279,17029395-17029481, 17029570-17029629 Length = 395 Score = 26.6 bits (56), Expect = 9.2 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -1 Query: 242 LFIVEMMSICLSIYNYEILCCLCISCVNPLLSSS 141 L + + +CL +++YEIL L NP L +S Sbjct: 171 LAVPSALMVCLEMWSYEILVLLSGRLPNPKLQTS 204 >04_04_0853 + 28745953-28747635 Length = 560 Score = 26.6 bits (56), Expect = 9.2 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 248 LNLFIVEMMSICLSIYNYEILCCLCISCVNP 156 ++L + +S+CL + YEI+ LC +NP Sbjct: 308 ISLALPSCVSVCLEWWWYEIMILLCGLLLNP 338 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,506,871 Number of Sequences: 37544 Number of extensions: 160127 Number of successful extensions: 328 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 326 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 871620292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -