BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0004.Seq (399 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P07856 Cluster: Sericin 1 precursor; n=4; Bombyx mori|R... 41 0.010 UniRef50_Q99GT5 Cluster: ORF131; n=3; Nucleopolyhedrovirus|Rep: ... 32 4.8 >UniRef50_P07856 Cluster: Sericin 1 precursor; n=4; Bombyx mori|Rep: Sericin 1 precursor - Bombyx mori (Silk moth) Length = 1186 Score = 40.7 bits (91), Expect = 0.010 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 302 VNRLLHKPGQGKICLC 255 VNRLLHKPGQGKICLC Sbjct: 1154 VNRLLHKPGQGKICLC 1169 Score = 39.1 bits (87), Expect = 0.031 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 252 ENIFDIPYHLRKNIGV 205 ENIFDIPYHLRKNIGV Sbjct: 1171 ENIFDIPYHLRKNIGV 1186 >UniRef50_Q99GT5 Cluster: ORF131; n=3; Nucleopolyhedrovirus|Rep: ORF131 - Helicoverpa zea SNPV Length = 192 Score = 31.9 bits (69), Expect = 4.8 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 160 LKHYKEYSKSCLVVLNTDILTEMVRNIEYVFEQ 258 L H + +K +V LN D + E V+NI++VFE+ Sbjct: 149 LNHLRSINKQKIVFLNGDHVEEYVQNIKHVFER 181 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 360,677,898 Number of Sequences: 1657284 Number of extensions: 6517373 Number of successful extensions: 11476 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11475 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 16926675320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -