BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0004.Seq (399 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4.05 |mlo2||zinc finger protein Mlo2|Schizosaccharomyces pom... 26 1.9 SPBC365.16 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 24 10.0 SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit ... 24 10.0 >SPBC4.05 |mlo2||zinc finger protein Mlo2|Schizosaccharomyces pombe|chr 2|||Manual Length = 329 Score = 26.2 bits (55), Expect = 1.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 214 YRCLIQLNTTWSIPCSV*DFKSYLMTSNDFNDNF 113 +RC T SIPC++ + ND+N NF Sbjct: 85 FRCDCGTTRTHSIPCNLRKSVDECGSENDYNHNF 118 >SPBC365.16 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 277 Score = 23.8 bits (49), Expect = 10.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 3 GRSLIIRLLSRQHNYIFFLPGTKPGLFMYA 92 GRS ++R +SR Y+ +KPG F ++ Sbjct: 53 GRSTLLRSVSRSIKYVL----SKPGAFFFS 78 >SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit Bgs4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1955 Score = 23.8 bits (49), Expect = 10.0 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = -1 Query: 387 RQFFYLGRFKYIGRFLHFV*CFQESSFRREQTFTQAWSRKNMPLLENIFDIPYHL 223 R+++YLG + RFL F F F F + M +L N+ I YH+ Sbjct: 1333 REYYYLGTQLQLDRFLSFY--FAHPGFHLNNMFIMLSVQLFMVVLINLGAI-YHV 1384 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,562,293 Number of Sequences: 5004 Number of extensions: 30651 Number of successful extensions: 57 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 134126124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -