BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0001.Seq (369 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43126| Best HMM Match : Myosin_head (HMM E-Value=4.1e-32) 27 6.3 SB_14127| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 >SB_43126| Best HMM Match : Myosin_head (HMM E-Value=4.1e-32) Length = 898 Score = 26.6 bits (56), Expect = 6.3 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 24 GFVWEDDDDLFPGFSDTFKMPEIPEIKSLEFDDIKTHVAG 143 GF + D LF + + +IP I++L DD+K + G Sbjct: 849 GFCERNRDVLFKDLIELMQSSDIPFIRTLFPDDVKAEMRG 888 >SB_14127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1185 Score = 26.6 bits (56), Expect = 6.3 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 195 TVNGKTVSSGGVSELTNDGKP 257 TVNGK VSS + T+ GKP Sbjct: 651 TVNGKVVSSSSSTISTSSGKP 671 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,451,783 Number of Sequences: 59808 Number of extensions: 149660 Number of successful extensions: 577 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 594991920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -