BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--1000 (592 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 23 1.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.6 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 22 4.5 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 22 4.5 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 4.5 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 5.9 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 23.0 bits (47), Expect = 1.9 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -3 Query: 539 TLNSEYG-DLVTGYPSTSQE*GRHMS 465 T NSE D V GYP++ Q RH + Sbjct: 11 TTNSEAARDFVQGYPASVQPLPRHFN 36 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.6 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +2 Query: 182 RGAIILAKLSVLPVRRGYWGNKIGSHTP 265 R + + +++ V G+W N I H+P Sbjct: 250 RADLWIIPIAIFLVSLGWWENYISRHSP 277 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.6 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +2 Query: 182 RGAIILAKLSVLPVRRGYWGNKIGSHTP 265 R + + +++ V G+W N I H+P Sbjct: 250 RADLWIIPIAIFLVSLGWWENYISRHSP 277 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.6 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +2 Query: 182 RGAIILAKLSVLPVRRGYWGNKIGSHTP 265 R + + +++ V G+W N I H+P Sbjct: 250 RADLWIIPIAIFLVSLGWWENYISRHSP 277 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.6 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +2 Query: 182 RGAIILAKLSVLPVRRGYWGNKIGSHTP 265 R + + +++ V G+W N I H+P Sbjct: 250 RADLWIIPIAIFLVSLGWWENYISRHSP 277 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +3 Query: 36 MMRFLRSCLYRNKHVPDSAHVSRHL 110 + ++ L + K PD A + RHL Sbjct: 43 LKNYVNCLLEKGKCTPDGAELKRHL 67 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = +3 Query: 279 HRQVWFRNSPADSCPSWYWYCV 344 HR +FR + W+W+ V Sbjct: 192 HRLAYFREDLGINLHHWHWHLV 213 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 4.5 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -1 Query: 199 KDNSASNGSGDFLAALHTQTNMTVVVANGNK 107 K NS +NGS D + ++ + NG+K Sbjct: 279 KPNSTTNGSPDVIKVEPELSDSEKTLCNGSK 309 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 5.9 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 Query: 406 ELTCSNPVHQP 374 E TC PVH+P Sbjct: 91 EPTCDEPVHRP 101 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,245 Number of Sequences: 336 Number of extensions: 3320 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14830622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -