BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--1000 (592 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 24 3.2 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 24 3.2 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 4.2 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 23 5.6 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 23 5.6 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 23 5.6 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 23 5.6 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 23 5.6 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 23 5.6 AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding pr... 23 5.6 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 5.6 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 7.4 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 7.4 AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding pr... 23 9.8 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 9.8 AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding pr... 23 9.8 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 24.2 bits (50), Expect = 3.2 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 369 KKLLRNWRRHNTSTTRGRNQPDCYGTTLAGDLAR-DGVWLP 250 K + + RR+++S+ + ++ D TTL D A VW P Sbjct: 15 KTTISSSRRYSSSSYQDQSMDDALNTTLTNDKATLIQVWKP 55 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 24.2 bits (50), Expect = 3.2 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 369 KKLLRNWRRHNTSTTRGRNQPDCYGTTLAGDLAR-DGVWLP 250 K + + RR+++S+ + ++ D TTL D A VW P Sbjct: 15 KTTISSSRRYSSSSYQDQSMDDALNTTLTNDKATLIQVWKP 55 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.8 bits (49), Expect = 4.2 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 124 QQRSYWFGCEVQQGSRHCHSRR 189 ++R+YW+ E+ Q HC R Sbjct: 268 RRRAYWWTTEIAQCRSHCIEAR 289 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 5.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 67 LYRHDLKNLIIQGRAEE 17 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 5.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 67 LYRHDLKNLIIQGRAEE 17 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 5.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 67 LYRHDLKNLIIQGRAEE 17 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 5.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 67 LYRHDLKNLIIQGRAEE 17 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 5.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 67 LYRHDLKNLIIQGRAEE 17 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 5.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 67 LYRHDLKNLIIQGRAEE 17 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding protein AgamOBP38 protein. Length = 336 Score = 23.4 bits (48), Expect = 5.6 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 306 PADSCPSWYWYCVCAS 353 PADSC YW C S Sbjct: 118 PADSCAGAYWSFRCYS 133 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.4 bits (48), Expect = 5.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 67 LYRHDLKNLIIQGRAEE 17 + RHD+ NL++Q R +E Sbjct: 275 IVRHDMINLLMQARKQE 291 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 7.4 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 303 SPADSCPSWYWYC 341 +P SCP YW C Sbjct: 879 TPVMSCPQDYWLC 891 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 7.4 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 303 SPADSCPSWYWYC 341 +P SCP YW C Sbjct: 879 TPVMSCPQDYWLC 891 >AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding protein AgamOBP50 protein. Length = 166 Score = 22.6 bits (46), Expect = 9.8 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -3 Query: 338 IPVPRGAGISRTVTEPHLPVTLQGTVCGFLSCY 240 + +P +T+ E + QGTVC F Y Sbjct: 35 LTLPTYGNCLQTIAEKYPDALWQGTVCAFDCTY 67 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 22.6 bits (46), Expect = 9.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 2 EIIDFFLGPSLNDEVLKIMPV 64 E ID F G L+ + LKI P+ Sbjct: 31 EYIDLFKGGHLSSDYLKINPL 51 >AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding protein OBPjj6b protein. Length = 315 Score = 22.6 bits (46), Expect = 9.8 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -3 Query: 338 IPVPRGAGISRTVTEPHLPVTLQGTVCGFLSCY 240 + +P +T+ E + QGTVC F Y Sbjct: 184 LTLPTYGNCLQTIAEKYPDALWQGTVCAFDCTY 216 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 672,794 Number of Sequences: 2352 Number of extensions: 14171 Number of successful extensions: 77 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -