BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0999 (707 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 24 1.2 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 8.7 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 8.7 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = -3 Query: 594 QEENQLNRINIMSDDHKCAFFFSTSLVTVLCR 499 ++E L+ + ++S+D FF +T + CR Sbjct: 438 EDETPLDPVVVISNDKSTEFFLATVVEEAACR 469 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 8.7 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 633 NAVWYTHFTA*RWQEENQLNRINIMSDD 550 +AV YTH+ +N L I+ + DD Sbjct: 166 SAVRYTHYIGTLATNDNILESISYVKDD 193 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.7 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +2 Query: 593 CQRYAVKWVYHTALSRASPAFGALVHRKTCTC 688 CQ KW ++ +S S +L+ T TC Sbjct: 359 CQNEMNKWWWNMKISNLSFDKQSLLKENTVTC 390 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,365 Number of Sequences: 438 Number of extensions: 3398 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -