BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0993 (584 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 23 2.5 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 4.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.4 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 21 5.8 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 22.6 bits (46), Expect = 2.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 110 WSITSTTLTNFPFKGPSATRATRPGCYVPCK 18 W IT + +FPF S T+ G Y P K Sbjct: 244 WHITDSH--SFPFTAESLPDLTKYGAYSPKK 272 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 4.4 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 514 KQYFLAGFLVAFLVRTFFAAALGIFF 437 + YF+ F+ FF AL IF+ Sbjct: 51 RTYFIYAFVAPVKCLAFFCTALVIFY 76 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.4 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 514 KQYFLAGFLVAFLVRTFFAAALGIFF 437 + YF+ F+ FF AL IF+ Sbjct: 284 RTYFIYAFVAPVKCLAFFCTALVIFY 309 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.4 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 514 KQYFLAGFLVAFLVRTFFAAALGIFF 437 + YF+ F+ FF AL IF+ Sbjct: 284 RTYFIYAFVAPVKCLAFFCTALVIFY 309 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +3 Query: 168 KPTPSHKIPPQIRVHSP 218 +P P H PP ++H P Sbjct: 29 QPLPRHFNPPSDKLHHP 45 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,763 Number of Sequences: 336 Number of extensions: 2764 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14621740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -